Property Summary

Ligand Count 481
NCBI Gene PubMed Count 374
PubMed Score 1500.26
PubTator Score 874.30

Knowledge Summary

Patent (102,421)

TINX Plot

  Disease (7)

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis 1.200 1.5e-02
Chronic Lymphocytic Leukemia 1.775 7.3e-04
cutaneous lupus erythematosus 2.400 5.8e-04
interstitial cystitis 1.700 1.5e-03
osteosarcoma -2.736 5.9e-06
primary Sjogren syndrome 1.600 3.0e-03
psoriasis 1.300 3.0e-03
sarcoidosis 1.100 3.8e-02
ulcerative colitis 1.700 1.5e-05

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (219)

AA Sequence

MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALH      1 - 70
SYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQ     71 - 140
LLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYT    141 - 210
NASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSM    211 - 280
SPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAE    281 - 350
GMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK    351 - 420
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYL    421 - 490
RSVLEDFFTATEGQYQPQP                                                       491 - 509
//

Text Mined References (398)

PMID Year Title