Property Summary

NCBI Gene PubMed Count 356
Grant Count 605
R01 Count 408
Funding $57,091,602.15
PubMed Score 1465.11
PubTator Score 874.30

Knowledge Summary

Patent (102,421)

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.775 0.001
cutaneous lupus erythematosus 2.400 0.001
psoriasis 2.700 0.000
osteosarcoma -2.736 0.000
Atopic dermatitis 1.200 0.015
sarcoidosis 1.100 0.038
interstitial cystitis 2.100 0.001
primary Sjogren syndrome 1.600 0.003
ulcerative colitis 1.700 0.000

Synonym

Accession P06239 D3DPP8 P07100 Q12850 Q13152 Q5TDH8 Q5TDH9 Q7RTZ3 Q96DW4 Q9NYT8
Symbols LSK
YT16
IMD22
p56lck
pp58lck

Gene

LCK

PDB

3BRH   1Q69   1Q68   1BHF   1BHH   1CWD   1CWE   1FBZ   1H92   1IJR   1KIK   1LCJ   1LCK   1LKK   1LKL   1QPC   1QPD   1QPE   1QPJ   1X27   2IIM   2OF2   2OF4   2OFU   2OFV   2OG8   2PL0   2ZM1   2ZM4   2ZYB   3AC1   3AC2   3AC3   3AC4   3AC5   3AC8   3ACJ   3ACK   3AD4   3AD5   3AD6   3B2W   3BYM   3BYO   3BYS   3BYU   3KMM   3KXZ   3LCK   3MPM   4C3F   4D8K  

  TechDev Info (1)

Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (238)

PMID Text
27091106 Aurora A inhibition causes delocalized clustering of Lck at the immunological synapses and decreases its phosphorylation levels thus indicating Aurora A is required for maintaining Lck active during T-cell activation.
26351666 These findings demonstrate highly dynamic Lck palmitoylation kinetics that are essential for signaling downstream of the Fas receptor.
26210498 Results demonstrate that Lck represses oxidative phosphorylation through competitive binding with mitochondrial CRIF1 in a kinase-independent manner.
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
26147390 introducing bulky side-chains into this patch (GGxxG to GVxxL) impairs the Lck-independent role of CD4 in T cell activation upon TCR engagement of agonist and weak agonist stimulation.
25997448 our results support a novel function of nuclear Lck in promoting human leukemic T cell survival through interaction with a tumor suppressor, CRIF1
25947381 T cell receptor (TCR)-CD3 complex and the Lck kinase were required for Ca(2+) mobilization but not for apoptosis induction in Jurkat cells.
25658353 In T-cells, cholesterol-dependent domains function in the regulation of the Src family kinase Lck (p56lck) by sequestering Lck from its activator CD45. (Review)
25595912 Cells from PAX5 translocated patients show LCK up-regulation and over-activation, as well as STAT5 hyper-phosphorylation, compared to PAX5 wt and PAX5 deleted cases.
25492967 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
More...

AA Sequence

MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALH      1 - 70
SYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQ     71 - 140
LLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYT    141 - 210
NASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSM    211 - 280
SPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAE    281 - 350
GMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK    351 - 420
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYL    421 - 490
RSVLEDFFTATEGQYQPQP                                                       491 - 509
//

Text Mined References (380)

PMID Year Title
27091106 2016 Aurora A drives early signalling and vesicle dynamics during T-cell activation.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26351666 2015 Rapid and transient palmitoylation of the tyrosine kinase Lck mediates Fas signaling.
26210498 2015 Lymphocyte-specific protein tyrosine kinase (Lck) interacts with CR6-interacting factor 1 (CRIF1) in mitochondria to repress oxidative phosphorylation.
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
26147390 2015 A Transmembrane Domain GGxxG Motif in CD4 Contributes to Its Lck-Independent Function but Does Not Mediate CD4 Dimerization.
25997448 2015 Nuclear lymphocyte-specific protein tyrosine kinase and its interaction with CR6-interacting factor 1 promote the survival of human leukemic T cells.
25947381 2015 Impact of Exogenous Galectin-9 on Human T Cells: CONTRIBUTION OF THE T CELL RECEPTOR COMPLEX TO ANTIGEN-INDEPENDENT ACTIVATION BUT NOT TO APOPTOSIS INDUCTION.
25658353 2015 Membrane-cytoskeleton interactions in cholesterol-dependent domain formation.
25595912 2015 LCK over-expression drives STAT5 oncogenic signaling in PAX5 translocated BCP-ALL patients.
More...