Property Summary

NCBI Gene PubMed Count 531
PubMed Score 285.22
PubTator Score 2867.06

Knowledge Summary

Patent (33,607)

TINX Plot

  Disease Sources (9)

Disease Target Count P-value
malignant mesothelioma 3163 9.15186004302692E-8
medulloblastoma, large-cell 6234 5.76847137396984E-6
psoriasis 6685 9.80594228390343E-6
dermatomyositis 967 8.90653250742309E-5
osteosarcoma 7933 2.3035296622819E-4
primary Sjogren syndrome 789 3.96576231344083E-4
ovarian cancer 8492 8.39369559466892E-4
ependymoma 2514 0.00253806857067496
pancreatic cancer 2300 0.00276938659046805
glioblastoma 5572 0.00348989557752586
adult high grade glioma 2148 0.00354194279870119
atypical teratoid / rhabdoid tumor 4369 0.00394394654564367
primary pancreatic ductal adenocarcinoma 1271 0.00431613091643707
astrocytoma 1493 0.00707747961387395
Multiple myeloma 1328 0.0119725706859527
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0161710752750279
esophageal adenocarcinoma 737 0.0217097485011888
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0272379516597552
pancreatic carcinoma 567 0.0299436539119556
Breast cancer 3099 0.0372607977242981
spina bifida 1064 0.0472604184360683
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Polycystic Ovary Syndrome 335 4.349 2.2
Gout 93 0.0 2.0
Retinal disease 16 0.0 1.0
Disease Target Count Z-score Confidence
Donohue Syndrome 6 5.599 2.8

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer -1.400 0.003
Multiple myeloma 1.672 0.012
malignant mesothelioma 1.700 0.000
astrocytoma 2.200 0.007
ependymoma -1.100 0.003
esophageal adenocarcinoma 1.800 0.022
psoriasis -2.700 0.000
osteosarcoma -2.019 0.000
atypical teratoid / rhabdoid tumor -1.200 0.004
glioblastoma -1.400 0.003
medulloblastoma, large-cell -2.200 0.000
primary pancreatic ductal adenocarcinoma -1.341 0.004
intraductal papillary-mucinous adenoma (... -1.300 0.016
intraductal papillary-mucinous neoplasm ... -1.400 0.027
Breast cancer 2.900 0.037
adult high grade glioma -1.200 0.004
primary Sjogren syndrome -1.500 0.000
pancreatic carcinoma 1.100 0.030
spina bifida -1.577 0.047
ovarian cancer -1.200 0.001
dermatomyositis 1.600 0.000

Synonym

Accession P06213 Q17RW0 Q59H98 Q9UCB7 Q9UCB8 Q9UCB9 IR
Symbols HHF5
CD220

Gene

PDB

3W11   3W12   3W13   4OGA   4XSS   2Z8C   2B4S   1GAG   1I44   1IR3   1IRK   1P14   1RQQ   2AUH   2HR7   2MFR   3BU3   3BU5   3BU6   3EKK   3EKN   3ETA   3W14   4IBM   4XLV   4XST   4ZXB   5E1S   5HHW   5J3H  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (282)

PMID Text
27172637 results indicate a significant correlation between T132903C and C109869T single nucleotide polymorphisms in the insulin receptor and solute carrier family 6 member 14 amino acid transporter (SLC6A14) genes with idiopathic infertility in Persian males
26874853 A novel insertion/deletion (indel) mutation was found in INSR gene.
26862994 Data indicate that a highly specific qRT-PCR assay to quantify levels of the insulin-like growth factor receptor and insulin receptor isoforms (IR-A, IR-B, and IGF-1R) on the same scale to provide a critical diagnostic and predictive tool.
26850678 Given the limited number of patients treated with KW-2450 in our study, it is not possible to make a meaningful comparison of efficacy with other IGF-1R/IR dual kinases inhibitors
26760116 Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells.
26721804 C1008T SNP at exon 17 of INSR is associated with insulin resistance in Indian women with polycystic ovarian syndrome.
26584640 mTORC2 promotes rapamycin- and ligand-induced type I insulin-like growth factor receptor / insulin receptor phosphorylation.
26438154 remarkable therapeutic window observed for BI 885578 is achieved by virtue of the distinctive pharmacokinetic properties of the compound capitalizing on the physiologic mechanism of glucose homeostasis and differential levels of IGF1R and INSR expression
26406954 The results demonstrate an increased IR-A:IR-B ratio in all clinical stages of breast cancer
26297026 Down-regulation of IR and IGF1R, achieved by insulin + fructose and monoclonal antibody treatments, results in decreased downstream signaling.
More...

AA Sequence

MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRP      1 - 70
EDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNIT     71 - 140
RGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCW    141 - 210
THSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRC    211 - 280
VNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDS    281 - 350
VTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL    351 - 420
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNG    421 - 490
DQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD    491 - 560
IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPIS    561 - 630
VSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQS    631 - 700
EYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNV    701 - 770
TVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV    771 - 840
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG    841 - 910
CRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLR    911 - 980
KRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEA    981 - 1050
ETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRP   1051 - 1120
EAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY   1121 - 1190
RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN   1191 - 1260
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLD   1261 - 1330
RSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS                     1331 - 1382
//

Text Mined References (558)

PMID Year Title
27172637 Four Single Nucleotide Polymorphisms in INSR, SLC6A14, TAS2R38, and OR2W3 Genes in Association with Idiopathic Infertility in Persian Men.
26874853 2016 First molecular diagnosis of Donohue syndrome in Africa: novel unusual insertion/deletion mutation in the INSR gene.
26862994 2016 Development of a Quantitative PCR Assay for Detection of Human Insulin-Like Growth Factor Receptor and Insulin Receptor Isoforms.
26850678 2016 Preclinical and first-in-human phase I studies of KW-2450, an oral tyrosine kinase inhibitor with insulin-like growth factor receptor-1/insulin receptor selectivity.
26760116 2016 Low Oxygen Tension Modulates the Insulin-Like Growth Factor-1 or -2 Signaling via Both Insulin-Like Growth Factor-1 Receptor and Insulin Receptor to Maintain Stem Cell Identity in Placental Mesenchymal Stem Cells.
26721804 2016 Single-Nucleotide Polymorphism on Exon 17 of Insulin Receptor Gene Influences Insulin Resistance in PCOS: A Pilot Study on North Indian Women.
26584640 2016 mTORC2 promotes type I insulin-like growth factor receptor and insulin receptor activation through the tyrosine kinase activity of mTOR.
26438154 2015 BI 885578, a Novel IGF1R/INSR Tyrosine Kinase Inhibitor with Pharmacokinetic Properties That Dissociate Antitumor Efficacy and Perturbation of Glucose Homeostasis.
26406954 2015 Quantification of insulin receptor mRNA splice variants as a diagnostic tumor marker in breast cancer.
26297026 2015 Insulin and IGF1 signalling pathways in human astrocytes in vitro and in vivo; characterisation, subcellular localisation and modulation of the receptors.
More...