Property Summary

NCBI Gene PubMed Count 39
PubMed Score 34.59
PubTator Score 57.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.8e-05
pancreatic ductal adenocarcinoma liver metastasis 1962 3.7e-03
Disease Target Count Z-score Confidence
Cholestasis 155 3.149 1.6
Gilbert syndrome 3 3.053 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.600 3.7e-03
psoriasis -1.400 1.8e-05

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPS      1 - 70
TLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKLMKKL     71 - 140
QESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIER    141 - 210
VKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGL    211 - 280
HCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLN    281 - 350
TRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM    351 - 420
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHS    421 - 490
LDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD                                    491 - 528
//

Text Mined References (43)

PMID Year Title