Property Summary

NCBI Gene PubMed Count 38
Grant Count 5
R01 Count 3
Funding $272,139.34
PubMed Score 34.62
PubTator Score 57.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.600 0.004
psoriasis -1.400 0.000

Synonym

Accession P06133 A6NCP7 B4DT75 G5E9X8 O60731 O60867 O75614 P36538 Q1HBF9 Q6QQX7 UDPGT 2B4
Symbols HLUG25
UDPGTH1
UGT2B11
UDPGT2B4
UDPGTh-1

Gene

PANTHER Protein Class (2)

Gene RIF (21)

PMID Text
25948711 These data indicate that knocking down PAPSS increases UGT2B4 transcription and mRNA stability as a compensatory response to the loss of SULT2A1 activity
22367021 The UGT1A8 and UGT2B4 genotypes associated with decreased predicted enzyme activities, were significantly associated with an increased risk of esophageal squamous cell carcinoma.
22092298 Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo
21660508 The variation pattern upstream UGT2B4 is highly unusual and may be the result of balancing selection.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20142249 Observational study of gene-disease association. (HuGE Navigator)
20139797 Extensive splicing of transcripts of the bile acid-conjugating enzyme UGT2B4 modulates glucuronidation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPS      1 - 70
TLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKLMKKL     71 - 140
QESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIER    141 - 210
VKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGL    211 - 280
HCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLN    281 - 350
TRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM    351 - 420
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHS    421 - 490
LDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD                                    491 - 528
//

Text Mined References (42)

PMID Year Title
25948711 2015 Upregulation of UGT2B4 Expression by 3'-Phosphoadenosine-5'-Phosphosulfate Synthase Knockdown: Implications for Coordinated Control of Bile Acid Conjugation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22367021 2012 High enzyme activity UGT1A1 or low activity UGT1A8 and UGT2B4 genotypes increase esophageal cancer risk.
22092298 2012 Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects.
21660508 2011 A signature of balancing selection in the region upstream to the human UGT2B4 gene and implications for breast cancer risk.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20142249 2010 Associations between polymorphisms in glucuronidation and sulfation enzymes and mammographic breast density in premenopausal women in the United States.
More...