Property Summary

NCBI Gene PubMed Count 80
Grant Count 183
R01 Count 109
Funding $24,966,343.55
PubMed Score 2510.47
PubTator Score 1565.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.012
psoriasis 1.900 0.000
osteosarcoma -1.074 0.008
intraductal papillary-mucinous adenoma (... 1.300 0.005
interstitial cystitis 1.300 0.001

Synonym

Accession P06127 A0N0P4 A8K9I3
Symbols T1
LEU1

Gene

CD5

PANTHER Protein Class (3)

PDB

2JA4   2JOP   2JP0   2OTT  

Gene RIF (56)

PMID Text
26800311 This study confirms the poor prognosis of de novo CD5+ DLBCL in a large multi-center cohort despite initial rituximab-containing chemotherapy and suggests that stem cell transplantation fails to salvage the majority of these patients.
26369546 5.2 % were positive for CD5 and 5.7 % positive for epstein-Barr virus encoded RNA
26363459 three tyrosine-based domains within CD5 cytoplasmic tail promote T-cell survival through non-overlapping mechanisms
25402503 CD5 polymorphisms are associated with systemic lupus erythematosus.
24928995 Data show that the proportion of CD5+ B cells at 1 mo of age is inversely correlated to total IgG levels at 18 and 36 mo of age.
24166616 A case of mantle cell lymphoma with a unique pattern of CD5 negative to positive expression switching in relapse.
24124149 CD5 expression in nodal marginal zone lymphoma correlates with a higher frequency of dissemination, but patients have an indolent clinical course and excellent overall survival.
24051121 down-regulation of CD5 on activated CD8(+) T cells may serve as a useful marker of dysregulated T cell activation and proliferation in FHL2.
23958552 useful in distinguishing thymic carcinoma from poorly differentiated lung carcinoma
22904299 Functional CD5-dependent casein kinase 2 signaling is necessary in a CD5 knock-in mouse for efficient differentiation of naive CD4+ T cells into T helper (Th)2 and Th17 cells, but not Th1-type cells.
More...

AA Sequence

MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQ      1 - 70
WEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTP     71 - 140
PTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFL    141 - 210
KHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG    211 - 280
GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQC    281 - 350
HELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP    351 - 420
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLH    421 - 490
GAQRL                                                                     491 - 495
//

Text Mined References (85)

PMID Year Title
26800311 2016 De novo CD5+ diffuse large B-cell lymphoma: Adverse outcomes with and without stem cell transplantation in a large, multicenter, rituximab treated cohort.
26369546 2015 CD5 positivity is an independent adverse prognostic factor in elderly patients with diffuse large B cell lymphoma.
26363459 2015 Functional requirement of tyrosine residue 429 within CD5 cytoplasmic domain for regulation of T cell activation and survival.
25402503 2014 Analysis of ancestral and functionally relevant CD5 variants in systemic lupus erythematosus patients.
24928995 2014 High proportion of CD5+ B cells in infants predicts development of allergic disease.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24166616 2014 Mantle cell lymphoma with a unique pattern of CD5 expression: a case report with review of the literatures.
24124149 2013 Clinicopathologic features of CD5-positive nodal marginal zone lymphoma.
24051121 2013 Down-regulation of CD5 expression on activated CD8+ T cells in familial hemophagocytic lymphohistiocytosis with perforin gene mutations.
23958552 Role of PAX-8, CD5, and CD117 in distinguishing thymic carcinoma from poorly differentiated lung carcinoma.
More...