Property Summary

NCBI Gene PubMed Count 90
PubMed Score 2574.03
PubTator Score 1565.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 1.2e-02
interstitial cystitis 1.300 7.4e-04
intraductal papillary-mucinous adenoma (... 1.300 5.3e-03
osteosarcoma -1.074 8.0e-03
psoriasis 1.900 7.1e-05

Gene RIF (67)

AA Sequence

MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQ      1 - 70
WEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTP     71 - 140
PTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFL    141 - 210
KHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG    211 - 280
GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQC    281 - 350
HELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP    351 - 420
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLH    421 - 490
GAQRL                                                                     491 - 495
//

Text Mined References (95)

PMID Year Title