Property Summary

NCBI Gene PubMed Count 86
PubMed Score 1433.09
PubTator Score 1104.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.200 9.9e-03
atypical teratoid / rhabdoid tumor 1.100 2.2e-03
cutaneous lupus erythematosus -3.100 1.3e-03
interstitial lung disease 1.500 2.9e-02
lung adenocarcinoma 1.300 6.2e-06
medulloblastoma, large-cell 1.600 1.2e-04
ovarian cancer 1.700 9.3e-09

Gene RIF (75)

AA Sequence

MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLCPW      1 - 70
SRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDF     71 - 140
VSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSH    141 - 210
GPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRV    211 - 280
KHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC                           281 - 327
//

Text Mined References (91)

PMID Year Title