Property Summary

NCBI Gene PubMed Count 81
Grant Count 155
R01 Count 91
Funding $24,082,808.7
PubMed Score 1264.65
PubTator Score 1104.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession P06126 D3DVD7 Q13962 Q5TDJ8 Q9UMM4 Q9Y5M5
Symbols R4
T6
CD1
FCB6
HTA1

Gene

PDB

4X6C   4X6D   1ONQ   1XZ0   4X6E   4X6F   5J1A  

Gene RIF (71)

PMID Text
26518708 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas
26460687 plasma-derived lipids drive functional levels of CD1d expression.
26442925 The data show that immunohistochemistry for CD1a and Hsp60 can be of help in differential diagnosis between Keratoacantomas and well-differentiated forms of squamous cell carcinomas.
26419626 Findings suggest that dermal survivin+CD1a+ (CD1a antigen) cell infiltration may be a potential biomarker of systemic sclerosis skin lesions.
26388332 Studies indicate that the antigen-presenting molecules CD1 and MHC class I-related protein (MR1) display lipids and small molecules to T cells.
26284469 Studies indicate that many CD1 antigen-restricted T cells do not require foreign antigens for activation but instead can be activated by self-lipids presented by CD1.
26116899 HIV-1 Vpr upregulates the gene expression of CD1A in human monocyte-derived dendritic cells
26073685 High CD1a-positive dendritic cell density is associated with improved disease-free survival in papillary thyroid carcinoma.
25901368 the expression of WNT4, a Wnt ligand, and three targets of Wnt-ss-catenin transcription activation, namely, MMP7, cyclinD1 (CD1) and c-MYC in 141 penile tissue cores from 101 unique samples, were investigated.
25343480 The presence of CD1a(+) T-cells in all of the LCH lesions that we have studied to date warrants further investigation into their biological function to determine whether these cells are important in the pathogenesis of LCH
More...

AA Sequence

MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLCPW      1 - 70
SRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDF     71 - 140
VSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSH    141 - 210
GPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRV    211 - 280
KHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC                           281 - 327
//

Text Mined References (86)

PMID Year Title
26518708 2015 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas.
26460687 2015 Expression of CD1a and Type-1 Polarization Are Dissociated in Human Monocyte-Derived Dendritic Cells.
26442925 2016 CD1A-positive cells and HSP60 (HSPD1) levels in keratoacanthoma and squamous cell carcinoma.
26419626 2015 CD1a+ survivin+ dendritic cell infiltration in dermal lesions of systemic sclerosis.
26388332 2015 Lipid and small-molecule display by CD1 and MR1.
26284469 2015 Activation of human T cells by CD1 and self-lipids.
26073685 2015 CD1a-positive dendritic cell density predicts disease-free survival in papillary thyroid carcinoma.
25901368 2015 Targets of Wnt/ß-catenin transcription in penile carcinoma.
25642819 2015 ?? T cell antigen receptor recognition of CD1a presenting self lipid ligands.
25343480 2014 Polyclonal T-cells express CD1a in Langerhans cell histiocytosis (LCH) lesions.
More...