Property Summary

NCBI Gene PubMed Count 54
PubMed Score 377.27
PubTator Score 27.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Malaria 160 3.383 1.7
Disease Target Count P-value
osteosarcoma 7950 2.9e-08
mucosa-associated lymphoid tissue lymphoma 484 1.7e-02
sarcoidosis 370 1.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 3.051 1.7e-02
osteosarcoma -6.101 2.9e-08
sarcoidosis 1.300 1.8e-02

Gene RIF (17)

AA Sequence

MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCV      1 - 70
MAGIIGTILLISYSIRRLIKA                                                      71 - 91
//

Text Mined References (56)

PMID Year Title