Property Summary

NCBI Gene PubMed Count 51
Grant Count 55
R01 Count 35
Funding $8,645,440.11
PubMed Score 365.53
PubTator Score 27.83

Knowledge Summary

Patent

No data available

Gene RIF (15)

PMID Text
24858913 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24738877 A novel GYPB mutation (c.270+5G>A) accounting for the S-s-U+(var) phenotype was identified.
21883272 Substitution of GPB with Gp.Mur significantly reduced the expression of Rh antigen and RhAG on the Mi.III(+/+) erythrocyte membrane
21283638 an increased susceptibility to infection by this parasite is associated with the glycophorin B S+ variant in Brazilian Amazons
20431033 Observational study of genetic testing. (HuGE Navigator)
19856717 This study reports for the first time the molecular mechanisms responsible for the S-s- phenotype in a population of African Brazilians and provides new information about the frequency and molecular bases of the GYPB*S silent gene in this population.
19279206 The erythrocyte-binding domain, region 2 of EBL-1, bound glycophorin B(+) but
18510579 Observational study of genetic testing. (HuGE Navigator)
18284304 Immunoblotting showed the presence of monomer and dimer forms of a GP(A-B) hybrid and an absence of GPA and GPB. Sequencing of DNA and PCR-RFLP using the restriction enzyme RsaI confirmed the presence of a hybrid GYP(AB).
18067501 Observational study of genetic testing. (HuGE Navigator)
More...

AA Sequence

MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCV      1 - 70
MAGIIGTILLISYSIRRLIKA                                                      71 - 91
//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24916810 2014 MN typing discrepancies based on GYPA-B-A hybrid.
24858913 2014 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24738877 2014 Family study of a Swiss patient uncovered a novel genetic basis for the S-s-U+(var) phenotype.
23944874 2014 Identification of binding domains on red blood cell glycophorins for Babesia divergens.
23756267 2013 Assessing the frequencies of GP.Mur (Mi.III) in several Southeast Asian populations by PCR typing.
23049422 2012 Molecular analysis of the GYPB gene to infer S, s, and U phenotypes in an admixed population of Minas Gerais, Brazil.
22924868 2013 A direct blood polymerase chain reaction approach for the determination of GP.Mur (Mi.III) and other Hil+ Miltenberger glycophorin variants.
21883272 2012 Expression of the Rh/RhAG complex is reduced in Mi.III erythrocytes.
21880045 2012 Anti-U-like as an alloantibody in S-s-U- and S-s-U+(var) black people.
More...