Property Summary

NCBI Gene PubMed Count 49
PubMed Score 44.58
PubTator Score 71.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
non-small cell lung cancer 2890 1.2e-18
Breast cancer 3578 2.4e-15
juvenile dermatomyositis 1187 7.9e-12
breast carcinoma 1638 8.2e-12
Duchenne muscular dystrophy 601 8.1e-11
nasopharyngeal carcinoma 1058 5.4e-06
lung adenocarcinoma 2716 9.9e-06
lung cancer 4740 6.5e-05
primary Sjogren syndrome 735 7.2e-05
ulcerative colitis 1819 9.5e-05
osteosarcoma 7950 2.5e-04
interstitial cystitis 2312 4.7e-04
urothelial carcinoma 318 6.4e-04
pancreatic cancer 2398 1.0e-03
pituitary cancer 1972 1.5e-03
acute quadriplegic myopathy 1158 2.5e-03
glioblastoma 5792 3.5e-03
limb girdle muscular dystrophy 2A 213 4.1e-03
ependymoma 4679 4.5e-03
Astrocytoma, Pilocytic 3081 6.8e-03
cystic fibrosis 1696 6.8e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 9.1e-03
gastric carcinoma 807 1.1e-02
astrocytic glioma 2597 1.2e-02
ovarian cancer 8520 1.2e-02
intraductal papillary-mucinous adenoma (IPMA) 2955 1.6e-02
esophageal adenocarcinoma 737 1.8e-02
Becker muscular dystrophy 191 2.3e-02
X-linked cerebral adrenoleukodystrophy 116 2.3e-02
invasive ductal carcinoma 2951 2.6e-02
adrenocortical carcinoma 1428 2.9e-02
head and neck cancer 271 3.1e-02
oligodendroglioma 2850 3.4e-02
interstitial lung disease 298 3.4e-02
sonic hedgehog group medulloblastoma 467 3.5e-02
ductal carcinoma in situ 1745 3.6e-02
subependymal giant cell astrocytoma 2287 4.1e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 4.3e-02
moderate Alzheimer's disease 1 4.8e-02
adult high grade glioma 3801 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Ehlers-Danlos syndrome 43 6.378 3.2

Expression

  Differential Expression (40)

Disease log2 FC p
acute quadriplegic myopathy 1.521 2.5e-03
adrenocortical carcinoma 1.483 2.9e-02
adult high grade glioma 1.300 4.9e-02
astrocytic glioma -1.100 1.2e-02
Astrocytoma, Pilocytic 1.400 6.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.936 9.1e-03
Becker muscular dystrophy 1.469 2.3e-02
Breast cancer 3.000 2.4e-15
breast carcinoma 1.400 8.2e-12
cystic fibrosis 1.400 6.8e-03
Duchenne muscular dystrophy 2.733 8.1e-11
ductal carcinoma in situ 1.500 3.6e-02
ependymoma 1.100 4.5e-03
esophageal adenocarcinoma 2.200 1.8e-02
gastric carcinoma 2.300 1.1e-02
glioblastoma 1.400 3.5e-03
head and neck cancer -1.100 3.1e-02
interstitial cystitis 1.400 4.7e-04
interstitial lung disease 1.200 3.4e-02
intraductal papillary-mucinous adenoma (... -2.100 1.6e-02
invasive ductal carcinoma 1.485 2.6e-02
juvenile dermatomyositis 2.232 7.9e-12
limb girdle muscular dystrophy 2A 1.170 4.1e-03
lung adenocarcinoma 1.400 9.9e-06
lung cancer 1.400 6.5e-05
moderate Alzheimer's disease -2.186 4.8e-02
nasopharyngeal carcinoma 2.300 5.4e-06
non-small cell lung cancer 2.547 1.2e-18
oligodendroglioma -1.100 3.4e-02
osteosarcoma 2.752 2.5e-04
ovarian cancer -1.800 1.2e-02
pancreatic cancer 1.700 1.0e-03
pancreatic ductal adenocarcinoma liver m... 2.106 4.3e-02
pituitary cancer 1.200 1.5e-03
primary Sjogren syndrome 1.200 7.2e-05
sonic hedgehog group medulloblastoma 1.300 3.5e-02
subependymal giant cell astrocytoma 2.280 4.1e-02
ulcerative colitis 3.100 9.5e-05
urothelial carcinoma 2.700 6.4e-04
X-linked cerebral adrenoleukodystrophy 1.100 2.3e-02

Gene RIF (23)

AA Sequence

MMANWAEARPLLILIVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQICVCDNGAIL      1 - 70
CDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVVTGIRGRPGPAGPPGSQ     71 - 140
GPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPSHPGPDGLSRPFSAQMAGLDEKSGLGSQVGL    141 - 210
MPGSVGPVGPRGPQGLQGQQGGAGPTGPPGEPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGF    211 - 280
AGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQ    281 - 350
GAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPG    351 - 420
AIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGI    421 - 490
QGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDP    491 - 560
GRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPG    561 - 630
EAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGD    631 - 700
PGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIA    701 - 770
GTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG    771 - 840
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGF    841 - 910
PGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGGPGDKGDPGEDGQPGPD    911 - 980
GPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEG    981 - 1050
PAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGL   1051 - 1120
PGPQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNP   1121 - 1190
GPLGPIGPPGVRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD   1191 - 1260
KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSVEDAIKVYCNM   1261 - 1330
ETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSPNTAITQMTFLRLLSKEASQN   1331 - 1400
ITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIRFRYIVLQDTCSKRNGNVGKTVFEYRTQNVA   1401 - 1470
RLPIIDLAPVDVGGTDQEFGVEIGPVCFV                                            1471 - 1499
//

Text Mined References (51)

PMID Year Title