Property Summary

NCBI Gene PubMed Count 56
Grant Count 30
R01 Count 18
Funding $3,646,724.06
PubMed Score 312.31
PubTator Score 87.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.205 0.011
pancreatic ductal adenocarcinoma liver m... -2.222 0.027
intraductal papillary-mucinous neoplasm ... -2.200 0.011
active Crohn's disease 1.003 0.018
breast carcinoma 1.400 0.001
fibroadenoma 1.200 0.018
Breast cancer 1.200 0.000
invasive ductal carcinoma 1.300 0.016
ovarian cancer -1.300 0.000
pancreatic cancer -2.300 0.001
psoriasis -1.400 0.000

Gene RIF (25)

PMID Text
26673890 These data demonstrate that the membrane-bound serine protease hepsin is the enzyme responsible for the physiological cleavage of uromodulin.
26165838 The findings suggest that the oncogenic activity of hepsin arises not only from elevated expression level but also from depletion of HAI-1, events which together trigger gain-of-function activity impacting HGF/MET signalling and epithelial cohesion
26139199 The Hepsin pathway acts in concert with Wnt pathway to promote prostate cancer progression.
26014348 Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival
25576733 Hepsin suppressed CDK11p58 internal ribosome entry site activity in prostate cancer cells by modulating UNR expression and eIF-2alpha phosphorylation.
22665141 The results of this study suggest that, in Korean men, some polymorphisms in the HPN gene might be associated with the risk of developing prostate cancer.
21875933 These findings suggest that the MSP/RON signaling pathway may be regulated by hepsin in tissue homeostasis and in disease pathologies, such as in cancer and immune disorders.
21750652 Elevated levels of hepsin interfere with cell adhesion and viability in the background of prostate cancer as well as other tissue types, the details of which depend on the microenvironment provided.
21383634 hepsin expression is frequently up-regulated in breast cancer tissues, which is associated with tumor growth and progression
20673210 Hepsin activity was inhibited by anthralin and increased by resveratrol.
More...

AA Sequence

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTE      1 - 70
GTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDC     71 - 140
PRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNR    141 - 210
VLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA    211 - 280
AGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQ    281 - 350
GDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL       351 - 417
//

Publication (58)

PMID Year Title
26673890 2015 The serine protease hepsin mediates urinary secretion and polymerisation of Zona Pellucida domain protein uromodulin.
26165838 2016 Deregulated hepsin protease activity confers oncogenicity by concomitantly augmenting HGF/MET signalling and disrupting epithelial cohesion.
26139199 2015 Concurrent Hepsin overexpression and adenomatous polyposis coli deletion causes invasive prostate carcinoma in mice.
26014348 2015 Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival.
25576733 2015 Hepsin inhibits CDK11p58 IRES activity by suppressing unr expression and eIF-2? phosphorylation in prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227843 2014 TMPRSS2 and ADAM17 cleave ACE2 differentially and only proteolysis by TMPRSS2 augments entry driven by the severe acute respiratory syndrome coronavirus spike protein.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
More...