Property Summary

NCBI Gene PubMed Count 18
Grant Count 6
R01 Count 6
Funding $1,385,660
PubMed Score 127.35
PubTator Score 57.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 4.600 0.000
medulloblastoma, large-cell 2.300 0.002
lung cancer -2.800 0.000
ovarian cancer 1.400 0.000

Gene RIF (6)

PMID Text
26011449 This study provides an additional mechanistic link between Angiotensin II and vasoconstriction via SFK-enhanced MLC phosphorylation in smooth muscle cells.
23319595 MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38
22131351 Disturbed myosin binding of mutated hVLC-1 may provide a pathomechanism for the development of hypertrohic cardiomyopathy.
21731751 Influenza infection activates a series of signaling pathways that converge to induce myosin light chain (MLC) phosphorylation and remodeling of the actin cytoskeleton.
20518849 In vitro degradation of human recombinant MLC1 by MMP-2 increased after ONOO(-) exposure of MLC1 in a concentration-dependent manner
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKI      1 - 70
TLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFD     71 - 140
KEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI                    141 - 194
//

Publication (19)

PMID Year Title
26011449 2015 Src Family Kinases (SFK) Mediate Angiotensin II-Induced Myosin Light Chain Phosphorylation and Hypertension.
23319595 2013 The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion.
22131351 2012 Mutations of ventricular essential myosin light chain disturb myosin binding and sarcomeric sorting.
21731751 2011 Inhibition of MLC phosphorylation restricts replication of influenza virus--a mechanism of action for anti-influenza agents.
20518849 2011 Ischemia induced peroxynitrite dependent modifications of cardiomyocyte MLC1 increases its degradation by MMP-2 leading to contractile dysfunction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707283 2001 Interaction of ADP-ribosylated actin with actin binding proteins.
More...