Property Summary

NCBI Gene PubMed Count 20
PubMed Score 129.29
PubTator Score 57.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Heart Injuries 3 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.5e-10
malignant mesothelioma 3232 3.5e-07
lung cancer 4740 1.2e-03
medulloblastoma, large-cell 6241 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -2.400 1.2e-03
malignant mesothelioma 4.600 3.5e-07
medulloblastoma, large-cell 2.300 2.3e-03
ovarian cancer 1.400 2.5e-10

Gene RIF (8)

AA Sequence

MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKI      1 - 70
TLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFD     71 - 140
KEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI                    141 - 194
//

Text Mined References (21)

PMID Year Title