Property Summary

NCBI Gene PubMed Count 18
PubMed Score 127.35
PubTator Score 57.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.52433540031771E-10
malignant mesothelioma 3163 3.52276235100131E-7
lung cancer 4473 5.99697682682073E-6
medulloblastoma, large-cell 6234 0.00227842392561138

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 4.600 0.000
medulloblastoma, large-cell 2.300 0.002
lung cancer -2.800 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P05976 B2R4N6 B2R4T6 P06741 Q6IBD5 MLC1/MLC3
Symbols MLC1F
MLC3F

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (6)

PMID Text
26011449 This study provides an additional mechanistic link between Angiotensin II and vasoconstriction via SFK-enhanced MLC phosphorylation in smooth muscle cells.
23319595 MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38
22131351 Disturbed myosin binding of mutated hVLC-1 may provide a pathomechanism for the development of hypertrohic cardiomyopathy.
21731751 Influenza infection activates a series of signaling pathways that converge to induce myosin light chain (MLC) phosphorylation and remodeling of the actin cytoskeleton.
20518849 In vitro degradation of human recombinant MLC1 by MMP-2 increased after ONOO(-) exposure of MLC1 in a concentration-dependent manner
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKI      1 - 70
TLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFD     71 - 140
KEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI                    141 - 194
//

Text Mined References (19)

PMID Year Title
26011449 2015 Src Family Kinases (SFK) Mediate Angiotensin II-Induced Myosin Light Chain Phosphorylation and Hypertension.
23319595 2013 The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion.
22131351 2012 Mutations of ventricular essential myosin light chain disturb myosin binding and sarcomeric sorting.
21731751 2011 Inhibition of MLC phosphorylation restricts replication of influenza virus--a mechanism of action for anti-influenza agents.
20518849 2011 Ischemia induced peroxynitrite dependent modifications of cardiomyocyte MLC1 increases its degradation by MMP-2 leading to contractile dysfunction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707283 2001 Interaction of ADP-ribosylated actin with actin binding proteins.
More...