Property Summary

NCBI Gene PubMed Count 45
PubMed Score 2149.90
PubTator Score 153.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 3.198 3.3e-02
adult high grade glioma -5.700 2.8e-10
astrocytic glioma -3.000 1.7e-02
Astrocytoma, Pilocytic -5.400 1.0e-09
atypical teratoid / rhabdoid tumor -2.800 1.3e-03
cystic fibrosis 1.100 2.6e-02
ependymoma -4.200 1.7e-03
glioblastoma -4.900 1.9e-08
group 3 medulloblastoma -1.800 1.5e-02
malignant mesothelioma 6.100 1.2e-09
medulloblastoma, large-cell -5.800 2.4e-08
non-small cell lung cancer 1.945 1.4e-05
oligodendroglioma -4.000 1.2e-03
Pick disease -1.300 5.9e-03
primitive neuroectodermal tumor -3.000 1.6e-03

Synonym

Accession P05937 B2R696 B7Z9J4
Symbols CALB
D-28K

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (26)

AA Sequence

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD      1 - 70
GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD     71 - 140
TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE    141 - 210
LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN                       211 - 261
//

Text Mined References (46)

PMID Year Title