Property Summary

NCBI Gene PubMed Count 43
Grant Count 290
R01 Count 182
Funding $25,603,907.89
PubMed Score 2070.55
PubTator Score 153.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 6.800 0.000
astrocytic glioma -3.000 0.017
ependymoma -4.200 0.002
oligodendroglioma -4.000 0.001
glioblastoma -5.400 0.000
group 4 medulloblastoma -6.600 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -6.400 0.000
primitive neuroectodermal tumor -3.400 0.001
adrenocortical carcinoma 3.198 0.033
non-small cell lung cancer 1.945 0.000
cystic fibrosis 1.100 0.026
adult high grade glioma -6.500 0.000
pilocytic astrocytoma -5.800 0.000
Pick disease -1.300 0.006

Synonym

Accession P05937 B2R696 B7Z9J4
Symbols CALB
D-28K

Gene

PANTHER Protein Class (1)

Gene RIF (24)

PMID Text
26417681 Age-related loss of CB appears to coincide with tangle formation in the BFCN and is associated with the full range of tau pathology, including late appearing epitopes.
26081613 Increased number of calbindin neurons and fiber labeling both in focal cortical dysplasia (FCD) and non-FCD specimens compared with postmortem controls may be associated with ongoing seizure activity.
24719368 expressed by different neuron types, both inhibitory (GABAergic) and excitatory (glutamatergic), involved in both intrinsic and extrinsic circuits of the human cerebellar cortex
23715974 The calbindin-D 28k was decreased in the putamen, the dorsal tier of the substantia nigra along the lower border of the red nucleus, and in the cerebellar cortex in multiple system atrophy.
22483853 Significantly reduced hippocampal calbindin D28K levels are found in all patients with mitochondrial encephalomyopathy, lactic acidosis and stroke-like syndrome (MELAS).
22272358 Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum.
21364983 Dynamics of Ca2+ ions within the solvation shell of calbindin D9k.
20452033 upregulated in endometriosis tissues
20214988 cultured syncytiotrophoblast cells express calbindin-D9k and calbindin-D28k genes, which are stimulated by calcitriol
20054781 calbindin may play a role in development of Purkinje cells located in heterotopias and cerebellar dysgenesias
More...

AA Sequence

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD      1 - 70
GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD     71 - 140
TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE    141 - 210
LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN                       211 - 261
//

Text Mined References (44)

PMID Year Title
26417681 2015 Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.
26081613 2015 Calcium-binding proteins in focal cortical dysplasia.
24719368 2014 Calbindin-D28K immunoreactivity in the human cerebellar cortex.
23715974 2013 Loss of DARPP-32 and calbindin in multiple system atrophy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22796338 2012 Correlation between calbindin expression in granule cells of the resected hippocampal dentate gyrus and verbal memory in temporal lobe epilepsy.
22483853 2012 Decreased hippocampal expression of calbindin D28K and cognitive impairment in MELAS.
22272358 2012 Distribution of GABAergic interneurons and dopaminergic cells in the functional territories of the human striatum.
21364983 2011 The dynamics of Ca2+ ions within the solvation shell of calbindin D9k.
21269460 2011 Initial characterization of the human central proteome.
More...