Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1579.47
PubTator Score 32.02

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession P05814 Q4VAZ9 Q9UCM5
Symbols CASB

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVE      1 - 70
PIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH     71 - 140
LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQI    141 - 210
YPVTQPLAPVHNPISV                                                          211 - 226
//

Text Mined References (26)

PMID Year Title