Property Summary

NCBI Gene PubMed Count 167
Grant Count 72
R01 Count 37
Funding $10,067,269.68
PubMed Score 689.82
PubTator Score 543.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
type II diabetes mellitus and post-ische... -1.100 0.023
diabetes mellitus 1.200 0.002
psoriasis -1.200 0.000

Synonym

Accession P05787 A8K4H3 B0AZN5 F8VXB4 Q14099 Q14716 Q14717 Q53GJ0 Q6DHW5 Q6GMY0 Q6P4C7 Q96J60
Symbols K8
KO
CK8
CK-8
CYK8
K2C8
CARD2

Gene

Gene RIF (103)

PMID Text
26911253 K8/18 filaments provide resistance to apoptosis in granulosa cell tumor cells by impairing FAS expression.
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
26847082 These metastatic tumors revealed no detectable expression of CK8/18, E-cadherin, VCAM-1, and ICAM-1
26286715 Variants in highly conserved residues of K8 Lys393Arg (ezetimibe/simvastatin-related) was found in patients with fatal Drug-induced liver injury.
26280121 In human failing myocardium, where TNF-alpha expression is upregulated, K8/K18 were also ectopically expressed
26277397 The reactivity of rheumatoid arthritis (RA) serum IgG antibodies against K8 was significantly higher than healthy controls and systemic lupus erythematosus patients, confirming K8 as a novel autoantigen of RA.
25963979 Human KRT8 variants promote acetaminophen induced hepatotoxicity in mouse models.
25724181 K8 immunostaining of tissue from the lymph node metastasis allows defining a sub-group of lymph node-positive breast cancer patients with a highly unfavourable outcome
25120060 Syndecan-1 is involved in morphogenesis of the developing tooth crown and cervical loops, andntogether with CK8 and vimentin in differentiation of preameloblasts and preodontoblasts.
25113562 Study indicates that Piwil2 plays a role in Fas-mediated apoptosis and can affect p53 phosphorylation in tumor cells, revealing a novel mechanism of Piwil2 in apoptosis, and supports that Piwil2 plays an active role in tumorigenesis.
More...

AA Sequence

MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQ      1 - 70
SLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMF     71 - 140
ESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVEL    141 - 210
ESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAES    211 - 280
MYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDAN    281 - 350
AKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA    351 - 420
GGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK           421 - 483
//

Text Mined References (186)

PMID Year Title
26911253 2016 Molecular manipulation of keratin 8/18 intermediate filaments: modulators of FAS-mediated death signaling in human ovarian granulosa tumor cells.
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
26847082 2016 Establishment and characterization of a metastasis model of human gastric cancer in nude mice.
26286715 2015 Prevalence of genetic variants of keratins 8 and 18 in patients with drug-induced liver injury.
26280121 2015 Tumor necrosis factor-? confers cardioprotection through ectopic expression of keratins K8 and K18.
26277397 2015 Keratin 8 is a novel autoantigen of rheumatoid arthritis.
25963979 2015 Human keratin 8 variants promote mouse acetaminophen hepatotoxicity coupled with c-jun amino-terminal kinase activation and protein adduct formation.
25724181 2015 In stage II/III lymph node-positive breast cancer patients less than 55 years of age, keratin 8 expression in lymph node metastases but not in the primary tumour is an indicator of better survival.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...