Property Summary

NCBI Gene PubMed Count 224
PubMed Score 1057.76
PubTator Score 871.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.800 1.5e-02
fibroadenoma 2.600 3.9e-02
psoriasis -1.100 7.6e-16

Gene RIF (152)

AA Sequence

MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGG      1 - 70
LAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI     71 - 140
FANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEEL    141 - 210
LFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTT    211 - 280
VVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELA    281 - 350
QTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS    351 - 420
ETNDTKVLRH                                                                421 - 430
//

Text Mined References (244)

PMID Year Title