Property Summary

NCBI Gene PubMed Count 198
Grant Count 67
R01 Count 33
Funding $5,921,816.35
PubMed Score 1010.30
PubTator Score 871.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.800 0.015
fibroadenoma 2.600 0.039
psoriasis -1.100 0.000

Synonym

Accession P05783 Q53G38 Q5U0N8 Q9BW26
Symbols K18
CK-18
CYK18

Gene

Gene RIF (131)

PMID Text
26911253 K8/18 filaments provide resistance to apoptosis in granulosa cell tumor cells by impairing FAS expression.
26728375 Data show that the decrease of keratin 18 (K18) ser33 and ser52 phosphorylation inhibited autophagy and decreased apoptosis of HCT116 cells.
26671131 High circulating CCCK-18 levels were associated with injury severity and a poor clinical outcome after aSAH and CCCK-18 had the potential to be a good prognostic biomarker for aSAH.
26436355 NAFLD patients, serum CK-18 levels reflect disease activity scores and correlate with histological changes.
26286715 Variants in highly conserved residues of K18 Asp89His (isoniazid-related) were found in patients with fatal Drug-induced liver injury.
26280121 In human failing myocardium, where TNF-alpha expression is upregulated, K8/K18 were also ectopically expressed
26138305 As an apoptosis-related biomarker, serum M30 [M30 cytokeratin-18 peptide, human ] level has a merit to be the most promising test for prediction or differential diagnosis of HELLP syndrome in PE patients.
25973684 The results suggest that oblongifolin C inhibits metastasis through the induction of the expression of keratin 18 and may be useful in cancer therapy.
25846732 Our results suggest that reliable detection of apoptosis via the M30 assay only works when sufficient levels of cytokeratin 18 are present in the cells. This means that the M30 assay may result in false negative results for apoptosis
25822281 Serum caspase-cleaved cytokeratin-18 levels are associated with 30-day mortality and could be used as a prognostic biomarker in patients with severe traumatic brain injury.
More...

AA Sequence

MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGG      1 - 70
LAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI     71 - 140
FANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEEL    141 - 210
LFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTT    211 - 280
VVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELA    281 - 350
QTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS    351 - 420
ETNDTKVLRH                                                                421 - 430
//

Text Mined References (217)

PMID Year Title
26911253 2016 Molecular manipulation of keratin 8/18 intermediate filaments: modulators of FAS-mediated death signaling in human ovarian granulosa tumor cells.
26728375 2016 [Keratin 18 phosphorylation increases autophagy of colorectal cancer HCT116 cells and enhanced its sensitivity to oxaliplatin].
26671131 2015 Serum caspase-cleaved cytokeratin-18 levels and outcomes after aneurysmal subarachnoid hemorrhage.
26436355 Correlation between serum cytokeratin-18 and the progression or regression of non-alcoholic fatty liver disease.
26286715 2015 Prevalence of genetic variants of keratins 8 and 18 in patients with drug-induced liver injury.
26280121 2015 Tumor necrosis factor-? confers cardioprotection through ectopic expression of keratins K8 and K18.
26138305 2016 Serum levels of ET-1, M30, and angiopoietins-1 and -2 in HELLP syndrome and preeclampsia compared to controls.
25973684 2015 Oblongifolin C inhibits metastasis by up-regulating keratin 18 and tubulins.
25846732 2015 The M30 assay does not detect apoptosis in epithelial-derived cancer cells expressing low levels of cytokeratin 18.
25822281 2015 Serum levels of caspase-cleaved cytokeratin-18 in patients with severe traumatic brain injury are associated with mortality: a pilot study.
More...