Property Summary

NCBI Gene PubMed Count 308
Grant Count 172
R01 Count 126
Funding $15,960,439.42
PubMed Score 83.47
PubTator Score 383.81

Knowledge Summary

Patent (10,807)

Expression

  Differential Expression (33)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.516 0.034
astrocytoma -4.000 0.000
ependymoma -4.900 0.004
oligodendroglioma -3.000 0.000
psoriasis -1.600 0.000
glioblastoma -4.800 0.000
osteosarcoma -3.731 0.000
group 3 medulloblastoma -4.300 0.001
atypical teratoid / rhabdoid tumor -6.400 0.000
medulloblastoma, large-cell -6.600 0.000
primitive neuroectodermal tumor -5.400 0.000
Atopic dermatitis -1.400 0.003
tuberculosis 1.900 0.000
non-small cell lung cancer -1.578 0.000
lung cancer -2.900 0.000
colon cancer -2.500 0.000
ulcerative colitis 2.000 0.001
sarcoidosis 1.200 0.005
interstitial cystitis 1.500 0.008
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -2.700 0.000
primary Sjogren syndrome 2.300 0.002
subependymal giant cell astrocytoma -4.081 0.008
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma 1.287 0.001
nasopharyngeal carcinoma -1.400 0.019
severe Alzheimer's disease -1.877 0.040
lung carcinoma -1.700 0.000
Pick disease -2.100 0.035
progressive supranuclear palsy 1.100 0.048
ovarian cancer -1.700 0.000
Down syndrome -1.100 0.034
head and neck cancer -1.600 0.006

Synonym

Accession P05771 C5IFJ8 D3DWF5 O43744 P05127 Q15138 Q93060 Q9UE49 Q9UE50 Q9UEH8 Q9UJ30 Q9UJ33 PKC-B
Symbols PKCB
PRKCB1
PRKCB2
PKC-beta

Gene

PDB

2I0E  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (218)

PMID Text
26545496 PKCbetaII inhibits the ubiquitination of beta-arrestin2 in an autophosphorylation-dependent manner
26540567 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3Kdelta or PKCbeta signaling pathways.
26459836 PPAR-delta and NKIRAS1 are downstream mediators in the PRKCB pathway in human umbilical vein endothelial cells.
26439941 Lower hydrogen sulfide is associated with cardiovascular mortality, which involves PKCBII/Akt pathway in chronic hemodialysis patients.
26343587 Study found a significant decrease of PRCKB1 mRNA expression in subsyndromal symptomatic depression, suggesting PRKCB1 might be a candidate gene and biomarker
26121314 Gene fusions involving PRKC genes occur in several morphological and clinical subsets of benign fibrous histiocytoma, but they seem to account for only a minority of the cases.
26008233 Effect of PKC-beta Signaling Pathway on Expression of MCP-1 and VCAM-1 in Different Cell Models in Response to Advanced Glycation End Products
25982096 Our data indicate a new direction for LOX-1 regulation by the modulation of the PKCbeta/NAPDH oxidase/SIRT1/HSF1 mechanism
25927959 that the high-concentration glucose-induced disruption of endothelial adherens junctions is mediated by tyrosine phosphorylation of vascular endothelial cadherin through PKC-beta and myosin light chain phosphorylation
25882844 human AKAP79-anchored PKC selectively phosphorylates the Robo3.1 receptor subtype on serine 1330
More...

AA Sequence

MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVC      1 - 70
CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVH     71 - 140
KRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQ    141 - 210
KTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQ    211 - 280
EEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGK    281 - 350
GSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM    351 - 420
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKE    421 - 490
NIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAY    491 - 560
PKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF    561 - 630
DKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV                                 631 - 671
//

Text Mined References (319)

PMID Year Title
26545496 2015 PKC?II inhibits the ubiquitination of ?-arrestin2 in an autophosphorylation-dependent manner.
26540567 2015 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3K? or PKC? signaling pathways.
26459836 2015 Subcellular proteomic approach for identifying the signaling effectors of protein kinase C-?? under high glucose conditions in human umbilical vein endothelial cells.
26439941 2015 Lower Hydrogen Sulfide Is Associated with Cardiovascular Mortality, Which Involves cPKC?II/Akt Pathway in Chronic Hemodialysis Patients.
26343587 2015 Down-regulation of PRKCB1 expression in Han Chinese patients with subsyndromal symptomatic depression.
26121314 2015 Gene fusion detection in formalin-fixed paraffin-embedded benign fibrous histiocytomas using fluorescence in situ hybridization and RNA sequencing.
26008233 2015 Effect of PKC-? Signaling Pathway on Expression of MCP-1 and VCAM-1 in Different Cell Models in Response to Advanced Glycation End Products (AGEs).
25982096 2015 Homocysteine facilitates LOX-1 activation and endothelial death through the PKC? and SIRT1/HSF1 mechanism: relevance to human hyperhomocysteinaemia.
25927959 2014 Disruption of endothelial adherens junctions by high glucose is mediated by protein kinase C-?-dependent vascular endothelial cadherin tyrosine phosphorylation.
25882844 2015 A-kinase Anchoring Protein 79/150 Recruits Protein Kinase C to Phosphorylate Roundabout Receptors.
More...