Property Summary

NCBI Gene PubMed Count 308
PubMed Score 83.47
PubTator Score 383.81

Knowledge Summary

Patent (10,807)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 4.93608034785738E-29
non-small cell lung cancer 2798 1.7931371409472E-16
oligodendroglioma 2849 1.80981981481879E-14
atypical teratoid / rhabdoid tumor 4369 3.84432266222487E-12
tuberculosis 1563 5.7929062968497E-10
psoriasis 6685 6.62129529301572E-9
lung adenocarcinoma 2714 1.77734918678423E-8
primitive neuroectodermal tumor 3031 5.60295396352063E-7
ovarian cancer 8492 6.42328577822741E-7
pilocytic astrocytoma 3086 3.463703308397E-6
lung cancer 4473 4.84497357840763E-6
medulloblastoma, large-cell 6234 5.12029003716109E-6
adult high grade glioma 2148 5.51443100356182E-5
osteosarcoma 7933 1.10522557031051E-4
glioblastoma 5572 1.20786852719193E-4
colon cancer 1475 1.48192123173387E-4
astrocytoma 1493 4.21413009545732E-4
ulcerative colitis 2087 5.67591228355643E-4
group 3 medulloblastoma 2254 7.12813109338805E-4
invasive ductal carcinoma 2950 0.00124254842509969
primary Sjogren syndrome 789 0.00160872501067487
Atopic dermatitis 944 0.00310707033344899
ependymoma 2514 0.00352115835176186
sarcoidosis 368 0.00518672605392666
head and neck cancer 270 0.00641046419470261
interstitial cystitis 2299 0.00808197330849569
subependymal giant cell astrocytoma 2287 0.00816059332991156
nasopharyngeal carcinoma 1056 0.0191365465642433
Waldenstrons macroglobulinemia 765 0.0337903616376147
Down syndrome 548 0.0343455177127635
Pick disease 1893 0.0353726414784658
severe Alzheimer's disease 49 0.0398038871925234
progressive supranuclear palsy 674 0.0475822839190937
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Rheumatoid Arthritis 1171 0.0 1.0

Expression

  Differential Expression (33)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.516 0.034
astrocytoma -4.000 0.000
ependymoma -4.900 0.004
oligodendroglioma -3.000 0.000
psoriasis -1.600 0.000
glioblastoma -4.800 0.000
osteosarcoma -3.731 0.000
group 3 medulloblastoma -4.300 0.001
atypical teratoid / rhabdoid tumor -6.400 0.000
medulloblastoma, large-cell -6.600 0.000
primitive neuroectodermal tumor -5.400 0.000
Atopic dermatitis -1.400 0.003
tuberculosis 1.900 0.000
non-small cell lung cancer -1.578 0.000
lung cancer -2.900 0.000
colon cancer -2.500 0.000
ulcerative colitis 2.000 0.001
sarcoidosis 1.200 0.005
interstitial cystitis 1.500 0.008
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -2.700 0.000
primary Sjogren syndrome 2.300 0.002
subependymal giant cell astrocytoma -4.081 0.008
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma 1.287 0.001
nasopharyngeal carcinoma -1.400 0.019
severe Alzheimer's disease -1.877 0.040
lung carcinoma -1.700 0.000
Pick disease -2.100 0.035
progressive supranuclear palsy 1.100 0.048
ovarian cancer -1.700 0.000
Down syndrome -1.100 0.034
head and neck cancer -1.600 0.006

Synonym

Accession P05771 C5IFJ8 D3DWF5 O43744 P05127 Q15138 Q93060 Q9UE49 Q9UE50 Q9UEH8 Q9UJ30 Q9UJ33 PKC-B
Symbols PKCB
PRKCB1
PRKCB2
PKC-beta

Gene

PDB

2I0E  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (213)

PMID Text
26545496 PKCbetaII inhibits the ubiquitination of beta-arrestin2 in an autophosphorylation-dependent manner
26540567 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3Kdelta or PKCbeta signaling pathways.
26459836 PPAR-delta and NKIRAS1 are downstream mediators in the PRKCB pathway in human umbilical vein endothelial cells.
26439941 Lower hydrogen sulfide is associated with cardiovascular mortality, which involves PKCBII/Akt pathway in chronic hemodialysis patients.
26343587 Study found a significant decrease of PRCKB1 mRNA expression in subsyndromal symptomatic depression, suggesting PRKCB1 might be a candidate gene and biomarker
26121314 Gene fusions involving PRKC genes occur in several morphological and clinical subsets of benign fibrous histiocytoma, but they seem to account for only a minority of the cases.
26008233 Effect of PKC-beta Signaling Pathway on Expression of MCP-1 and VCAM-1 in Different Cell Models in Response to Advanced Glycation End Products
25982096 Our data indicate a new direction for LOX-1 regulation by the modulation of the PKCbeta/NAPDH oxidase/SIRT1/HSF1 mechanism
25927959 that the high-concentration glucose-induced disruption of endothelial adherens junctions is mediated by tyrosine phosphorylation of vascular endothelial cadherin through PKC-beta and myosin light chain phosphorylation
25882844 human AKAP79-anchored PKC selectively phosphorylates the Robo3.1 receptor subtype on serine 1330
More...

AA Sequence

MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVC      1 - 70
CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVH     71 - 140
KRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQ    141 - 210
KTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQ    211 - 280
EEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGK    281 - 350
GSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM    351 - 420
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKE    421 - 490
NIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAY    491 - 560
PKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF    561 - 630
DKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV                                 631 - 671
//

Text Mined References (319)

PMID Year Title
26545496 2015 PKC?II inhibits the ubiquitination of ?-arrestin2 in an autophosphorylation-dependent manner.
26540567 2015 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3K? or PKC? signaling pathways.
26459836 2015 Subcellular proteomic approach for identifying the signaling effectors of protein kinase C-?? under high glucose conditions in human umbilical vein endothelial cells.
26439941 2015 Lower Hydrogen Sulfide Is Associated with Cardiovascular Mortality, Which Involves cPKC?II/Akt Pathway in Chronic Hemodialysis Patients.
26343587 2015 Down-regulation of PRKCB1 expression in Han Chinese patients with subsyndromal symptomatic depression.
26121314 2015 Gene fusion detection in formalin-fixed paraffin-embedded benign fibrous histiocytomas using fluorescence in situ hybridization and RNA sequencing.
26008233 2015 Effect of PKC-? Signaling Pathway on Expression of MCP-1 and VCAM-1 in Different Cell Models in Response to Advanced Glycation End Products (AGEs).
25982096 2015 Homocysteine facilitates LOX-1 activation and endothelial death through the PKC? and SIRT1/HSF1 mechanism: relevance to human hyperhomocysteinaemia.
25927959 2014 Disruption of endothelial adherens junctions by high glucose is mediated by protein kinase C-?-dependent vascular endothelial cadherin tyrosine phosphorylation.
25882844 2015 A-kinase Anchoring Protein 79/150 Recruits Protein Kinase C to Phosphorylate Roundabout Receptors.
More...