Property Summary

NCBI Gene PubMed Count 1,013
Grant Count 93
R01 Count 38
Funding $9,134,848.64
PubMed Score 1198.08
PubTator Score 1599.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P05556 A8K6N2 D3DRX9 D3DRY3 D3DRY4 D3DRY5 P78466 P78467 Q13089 Q13090 Q13091 Q13212 Q14622 Q14647 Q29RW2 Q7Z3V1 Q8WUM6
Symbols CD29
FNRB
MDF2
VLAB
GPIIA
MSK12
VLA-BETA

Gene

PDB

3T9K   3VI3   3VI4   4WJK   4WK0   4WK2   4WK4   1K11   4DX9   1LHA   3G9W  

Gene RIF (825)

PMID Text
27066976 GM2 mediats tumor cell migration by interacting with ITGB1 leading to downstream signaling and the phosphorylation of ERK MAP kinases.
26992288 G-CSF stimulates beta1 integrin expression and Swan 71 cell migration by activating PI3K and MAPK signaling pathways.
26952307 Inhibition of integrin beta1 activation on the cortex and disruption of its asymmetric distribution leads to spindle misorientation.
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26895964 These results indicate that the effects of GMFG on monocyte migration and adhesion probably occur through preventing ubiquitin-mediated proteasome degradation of alpha5beta1-integrin and facilitating effective beta1-integrin recycling back to the plasma membrane.
26860947 We report that targeting HER3 and b1 integrin provides a particularly effective combination therapy approach for HER2-amplified cancers, surpassing the combination of HER2 and b1 integrin targeting, and evading some of the safety concerns associated with direct HER2-targeting.
26693891 Twist-ITGB1-FAK/ILK pathway and their downstream signaling network dictate the Twist-induced EMT process in human mammary epithelial cells and breast cancer cells
26648324 The aim of the present study was to characterize the roles of ITGalpha5 and ITGbeta1 in the proliferation and migration of vascular smooth muscle cells.
26641717 establish a paradigm according to which retrograde trafficking, and not endosomal recycling, is the key driver for beta1 integrin function in highly polarized cells
26540630 Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells via integrin beta1 signaling.
More...

AA Sequence

MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEAL      1 - 70
KKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAED     71 - 140
YPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSE    141 - 210
QNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDA    211 - 280
GFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKN    281 - 350
LIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI    351 - 420
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACR    421 - 490
CNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNC    491 - 560
DRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTC    561 - 630
EMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCW    631 - 700
FYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEK    701 - 770
MNAKWDTGENPIYKSAVTTVVNPKYEGK                                              771 - 798
//

Text Mined References (1038)

PMID Year Title
27066976 2016 Ganglioside GM2 mediates migration of tumor cells by interacting with integrin and modulating the downstream signaling pathway.
26992288 2016 Granulocyte colony-stimulating factor (G-CSF) upregulates ?1 integrin and increases migration of human trophoblast Swan 71 cells via PI3K and MAPK activation.
26952307 2016 A ligand-independent integrin ?1 mechanosensory complex guides spindle orientation.
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26895964 2016 Glia Maturation Factor-? Regulates Monocyte Migration through Modulation of ?1-Integrin.
26860947 2016 Effective treatment of HER2-amplified breast cancer by targeting HER3 and ?1 integrin.
26693891 2016 Twist induces epithelial-mesenchymal transition and cell motility in breast cancer via ITGB1-FAK/ILK signaling axis and its associated downstream network.
26648324 2016 Effects of integrin ?5?1 on the proliferation and migration of human aortic vascular smooth muscle cells.
26641717 2016 Persistent cell migration and adhesion rely on retrograde transport of ?(1) integrin.
26540630 2015 Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells by requirement of integrin ?1.
More...