Property Summary

NCBI Gene PubMed Count 165
Grant Count 734
R01 Count 475
Funding $72,218,925.08
PubMed Score 267.23
PubTator Score 768.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
cutaneous lupus erythematosus -1.300 0.025
psoriasis -3.500 0.000
oligodendroglioma 1.500 0.000
osteosarcoma 1.125 0.001
cystic fibrosis 3.805 0.000
atypical teratoid / rhabdoid tumor 2.600 0.004
non-small cell lung cancer 3.630 0.000
intraductal papillary-mucinous carcinoma... 3.900 0.001
lung cancer 5.100 0.000
colon cancer 1.600 0.000
pancreatic cancer 2.300 0.000
Breast cancer 3.500 0.029
interstitial cystitis -1.100 0.001
lung adenocarcinoma 1.400 0.000
sonic hedgehog group medulloblastoma 2.400 0.008
spina bifida -1.807 0.028
ductal carcinoma in situ 2.800 0.010
invasive ductal carcinoma 3.200 0.025
ovarian cancer 2.600 0.000

Synonym

Accession P05549 Q13777 Q5TAV5 Q8N1C6 AP2-alpha
Symbols AP-2
BOFS
AP2TF
TFAP2
AP-2alpha

Gene

PANTHER Protein Class (1)

Gene RIF (128)

PMID Text
26819314 role in the expression of Latent membrane protein 1
26780928 AP-2alpha expression has a role in human hepatocellular cancer by regulating signaling to affect cell growth and migration
26423947 shRNA knockdown of TFAP2A (AP2) strongly impairs the capacity of Nef to downmodulate CD4 in primary CD4+ T cells and SupT1 T cells; Nef-mediated downmodulation of CD4 is enhanced by TFAP2A (AP2)
26073327 Hepatitis B virus X protein is able to elevate the expression of SPHK1 in hepatoma cells by upregulating transcription factor AP2 alpha.
25953442 TFAP2A might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
25674231 The AP-2alpha transcription factor may play an important role in suppressing glioma progression.
25669978 Results indicate that AP-2alpha activates COX-2 expression to promote NPC growth.
25651508 ETS1 induction of syncytiotrophoblast marker genes likely results in part from transactivation by activator protein-2alpha.
25625848 Human melanomas display higher than normal CpG DNA methylation at the TFAP2A promoter.Aberrant CpG DNA methylation as an epigenetic mark associated with TFAP2A silencing in human melanoma.
25590586 Direct sequencing of the coding region of the TFAP2A gene revealed missense mutations in four branchio-oculo-facial syndrome patients; one patient was observed to have a previously described mutation (p.Arg251Gly), while three patients from two families were found to have novel mutations: p.Arg213Ser and p.Val210Asp.
More...

AA Sequence

MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQ      1 - 70
DPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHAL     71 - 140
SSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEV    141 - 210
FCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGR    211 - 280
RKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTD    281 - 350
LLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS    351 - 420
HTDNNAKSSDKEEKHRK                                                         421 - 437
//

Text Mined References (168)

PMID Year Title
26819314 2016 Induction of Epstein-Barr Virus Oncoprotein LMP1 by Transcription Factors AP-2 and Early B Cell Factor.
26780928 2016 AP-2? inhibits hepatocellular carcinoma cell growth and migration.
26073327 2015 Hepatitis B virus X protein promotes human hepatoma cell growth via upregulation of transcription factor AP2? and sphingosine kinase 1.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
25674231 2014 Ectopic expression of AP-2? transcription factor suppresses glioma progression.
25669978 2015 Activating enhancer-binding protein-2? induces cyclooxygenase-2 expression and promotes nasopharyngeal carcinoma growth.
25651508 2015 ETS1 induces human trophoblast differentiation.
25625848 2014 Aberrant CpG methylation of the TFAP2A gene constitutes a mechanism for loss of TFAP2A expression in human metastatic melanoma.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25590586 2015 A clinical and molecular analysis of branchio-oculo-facial syndrome patients in Russia revealed new mutations in TFAP2A.
More...