Property Summary

NCBI Gene PubMed Count 55
PubMed Score 745.33
PubTator Score 387.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease 2.800 3.2e-02
lung cancer 1.700 3.1e-03
malignant mesothelioma -2.100 1.2e-07
pancreatic ductal adenocarcinoma liver m... -3.315 2.0e-02
psoriasis 1.100 1.6e-08
sarcoidosis -1.300 2.7e-02

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDWI      1 - 70
PEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGKSRIQRLNILNAKFAFNLYRV     71 - 140
LKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLF    141 - 210
RRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALEN    211 - 280
IDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV    281 - 350
GGISMLIVVPHKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK    351 - 420
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIYEHRTSCLLFM    421 - 490
GRVANPSRS                                                                 491 - 499
//

Text Mined References (60)

PMID Year Title