Property Summary

NCBI Gene PubMed Count 52
Grant Count 73
R01 Count 40
Funding $15,765,864.96
PubMed Score 739.23
PubTator Score 387.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease 2.800 0.032
malignant mesothelioma -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -3.315 0.020
lung cancer 1.700 0.003
sarcoidosis -1.300 0.027
psoriasis 1.100 0.000

Synonym

Accession P05546 B2RAI1 D3DX34 Q6IBZ5
Symbols HC2
LS2
HCF2
HCII
HLS2
THPH10
D22S673

Gene

PDB

1JMO   1JMJ   2NAT  

Gene RIF (21)

PMID Text
25130770 heparin co-factor II is a novel metastasis enhancer and may be used as a prognostic predictor for heparin treatment in non-small cell lung cancer
23656734 In this study, we demonstrate a previously unknown role for HCII in host defense.
23496873 Molecular modelling of HCII 1-75 predicted those portions of the acidic extension that had been previously visualized in crystal structures, and suggested that an alpha-helix found between residues 26 and 36 stabilizes one found between residues 61-67.
22904320 HCII potentiates the activation of vascular endothelial cells and the promotion of angiogenesis in response to hindlimb ischemia via an AMPK-eNOS signaling pathway.
21107326 Plasma heparin cofactor II activity was independently and inversely associated with the development of cardiac remodeling, including cardiac concentric change, left atrial enlargement and left ventricular diastolic dysfunction.
20671370 [REVIEW]HCII protects against vascular remodeling, including atherosclerosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20053992 potential for oversulfated disaccharides in controlling HCII-regulated thrombin generation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19747479 These results suggest that HCII is in a position to inhibit thrombin in atherosclerotic lesions where thrombin can exert a proatherogenic inflammatory response.
More...

AA Sequence

MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDWI      1 - 70
PEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGKSRIQRLNILNAKFAFNLYRV     71 - 140
LKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLF    141 - 210
RRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALEN    211 - 280
IDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV    281 - 350
GGISMLIVVPHKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK    351 - 420
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIYEHRTSCLLFM    421 - 490
GRVANPSRS                                                                 491 - 499
//

Text Mined References (57)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25130770 2015 Heparin co-factor II enhances cell motility and promotes metastasis in non-small cell lung cancer.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23656734 2013 Proteolytic activation transforms heparin cofactor II into a host defense molecule.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23496873 2013 The complete N-terminal extension of heparin cofactor II is required for maximal effectiveness as a thrombin exosite 1 ligand.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22904320 2012 Heparin cofactor II, a serine protease inhibitor, promotes angiogenesis via activation of the AMP-activated protein kinase-endothelial nitric-oxide synthase signaling pathway.
21107326 2011 Plasma heparin cofactor II activity is inversely associated with left atrial volume and diastolic dysfunction in humans with cardiovascular risk factors.
20671370 2010 Heparin cofactor II attenuates vascular remodeling in humans and mice.
More...