Property Summary

NCBI Gene PubMed Count 43
Grant Count 21
R01 Count 1
Funding $3,993,229.26
PubMed Score 1106.56
PubTator Score 946.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.536 0.004

Gene RIF (11)

PMID Text
25361180 mutation in a liver-specific enhancer region of the TBG gene caused inherited TBG deficiency. To our knowledge, the present study is the first report of an inherited endocrine disorder caused by a mutation in an enhancer region.
23458682 TBG allosteric regulation is entropy driven. The presence of multiple S states may allow more efficient T4 release due to protease activity.
22820390 the TBG promoter has a role in sustaining transgene expression in liver-specific pattern
21325280 Allosteric modulation of hormone release from thyroxine and corticosteroid-binding globulins.
20429632 Freshly isolated TBG-Chicago exists in loop expelled conformation. At 37C, the protein readily converts to a more stable loop inserted conformation with enhanced heat stability.
19415532 new serpina7 gene variant in three members of the same family results in the replacement of the normal asparagine 233 by isoleucine and, subsequently, in disruption of a glycosylation site
17887925 guanine deletion at position 1711, codon 201 (Asp) in exon 2 (GAC --> AC) led to a frame shift and premature termination at codon 206, causing a short TBG protein of 205 amino acids (AA) compared to 395 AA of the normal TBG.
11931635 Loop variants of the serpin thyroxine-binding globulin: implications for hormone release upon limited proteolysis.
11916615 Two novel variants in the thyroxine-binding globulin gene behind the diagnosis of TBG deficiency. homozygous. One involved codon 23 (TCA-->TAA) and the other, codon 223.
11889160 an intragenic A/G polymorphism (125 bp upstream from exon 2) was identified. complete TBG deficiency was homozygous for the polymorphic TBG allele.
More...

AA Sequence

MSPFLYLVLLVLGLHATIHCASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFFSP      1 - 70
VSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLNFPKKELELQIGNALFIGKHL     71 - 140
KPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQW    141 - 210
ANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFVLPKEGQMESV    211 - 280
EAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNAA    281 - 350
HKAVLHIGEKGTEAAAVPEVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVVNPTEA         351 - 415
//

Text Mined References (47)

PMID Year Title
25361180 2015 A novel mechanism of inherited TBG deficiency: mutation in a liver-specific enhancer.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23458682 2013 The allosteric modulation of thyroxine-binding globulin affinity is entropy driven.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22820390 2012 Human thyroxine binding globulin (TBG) promoter directs efficient and sustaining transgene expression in liver-specific pattern.
21325280 2011 Allosteric modulation of hormone release from thyroxine and corticosteroid-binding globulins.
21269460 2011 Initial characterization of the human central proteome.
20429632 2010 Explanation for the high heat stability of thyroxine binding globulin-Chicago.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
More...