Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $65,450
PubMed Score 264.88
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus -1.300 0.037
psoriasis -1.800 0.000
cutaneous lupus erythematosus -2.600 0.011
Atopic dermatitis -1.600 0.001
lung cancer -3.600 0.000
breast carcinoma 1.100 0.001
lung carcinoma -1.900 0.000

Synonym

Accession P05538 A6NIA5 Q29826 Q29870 Q29871 Q29872 Q29873 Q5SR06
Symbols HLA-DXB
HLA-DQB1

Gene

 Grant Application (1)

Gene RIF (50)

PMID Text
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22407913 HLA-DQA2 and HLA-DQB2 genes are expressed in human Langerhans cells and encode a new HLA class II molecule.
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21778700 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21257290 Data show that two peptides with naturally processed DQ8 (DQA1 *0301/DQB1 *0302) epitopes bound protective DR0403 with longer half-life and lower dissociation rate than susceptible DR0401, confirming DR0403 as a better peptide competitor than DR0401.
20587610 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG      1 - 70
RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL     71 - 140
NHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS    141 - 210
LQSPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIRHRGQKGPRGPPPAGLLH                211 - 268
//

Text Mined References (35)

PMID Year Title
24940741 2014 A genome-wide association study on chronic HBV infection and its clinical progression in male Han-Taiwanese.
24162738 2013 New loci associated with chronic hepatitis B virus infection in Han Chinese.
23760081 2013 A genome-wide association study identified new variants associated with the risk of chronic hepatitis B.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
23053960 2012 Genome-wide pathway analysis of genome-wide association studies on systemic lupus erythematosus and rheumatoid arthritis.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
22407913 2012 HLA-DQA2 and HLA-DQB2 genes are specifically expressed in human Langerhans cells and encode a new HLA class II molecule.
21750111 2011 A genome-wide association study of chronic hepatitis B identified novel risk locus in a Japanese population.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
More...