Property Summary

NCBI Gene PubMed Count 27
PubMed Score 264.88
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus -1.300 0.037
psoriasis -1.800 0.000
cutaneous lupus erythematosus -2.600 0.011
Atopic dermatitis -1.600 0.001
lung cancer -3.600 0.000
breast carcinoma 1.100 0.001
lung carcinoma -1.900 0.000

Synonym

Accession P05538 A6NIA5 Q29826 Q29870 Q29871 Q29872 Q29873 Q5SR06
Symbols HLA-DXB
HLA-DQB1

Gene

  Ortholog (1)

Species Source
Horse OMA Inparanoid

Gene RIF (46)

PMID Text
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22407913 HLA-DQA2 and HLA-DQB2 genes are expressed in human Langerhans cells and encode a new HLA class II molecule.
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21778700 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21257290 Data show that two peptides with naturally processed DQ8 (DQA1 *0301/DQB1 *0302) epitopes bound protective DR0403 with longer half-life and lower dissociation rate than susceptible DR0401, confirming DR0403 as a better peptide competitor than DR0401.
20587610 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG      1 - 70
RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL     71 - 140
NHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS    141 - 210
LQSPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIRHRGQKGPRGPPPAGLLH                211 - 268
//

Text Mined References (35)

PMID Year Title
24940741 2014 A genome-wide association study on chronic HBV infection and its clinical progression in male Han-Taiwanese.
24162738 2013 New loci associated with chronic hepatitis B virus infection in Han Chinese.
23760081 2013 A genome-wide association study identified new variants associated with the risk of chronic hepatitis B.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
23053960 2012 Genome-wide pathway analysis of genome-wide association studies on systemic lupus erythematosus and rheumatoid arthritis.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
22407913 2012 HLA-DQA2 and HLA-DQB2 genes are specifically expressed in human Langerhans cells and encode a new HLA class II molecule.
21750111 2011 A genome-wide association study of chronic hepatitis B identified novel risk locus in a Japanese population.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
More...