Property Summary

NCBI Gene PubMed Count 29
PubMed Score 276.02
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -1.600 1.3e-03
Barrett's esophagus -1.300 3.7e-02
breast carcinoma 1.100 1.1e-03
cutaneous lupus erythematosus -2.600 1.1e-02
lung cancer -1.700 2.1e-03
lung carcinoma -1.900 6.2e-23
psoriasis -1.800 1.2e-05

Protein-protein Interaction (4)

Gene RIF (48)

AA Sequence

MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG      1 - 70
RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL     71 - 140
NHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS    141 - 210
LQSPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIRHRGQKGPRGPPPAGLLH                211 - 268
//

Text Mined References (37)

PMID Year Title