Property Summary

NCBI Gene PubMed Count 24
PubMed Score 13.38
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 2.8e-03
Disease Target Count Z-score Confidence
Spindle cell hemangioma 16 3.642 1.8
Neuronal ceroid lipofuscinosis 28 3.09 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.200 2.8e-03

Gene RIF (3)

AA Sequence

MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFI      1 - 70
GAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM         71 - 136
//

Text Mined References (24)

PMID Year Title