Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.47
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.200 0.003

Synonym

Accession P05496
Symbols ATP5A
ATP5G

Gene

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19889836 The subunit c isoforms are nonredundant, because they differ functionally by their targeting peptides, which, in addition to mediating mitochondrial protein import, play a yet undiscovered role in respiratory chain maintenance.

AA Sequence

MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFI      1 - 70
GAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM         71 - 136
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19889836 2010 Novel role of ATPase subunit C targeting peptides beyond mitochondrial protein import.
16381901 2006 The LIFEdb database in 2006.
15906478 2005 Full-length coding sequences and mapping of porcine ATP6VOE and ATP5G1 genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...