Property Summary

NCBI Gene PubMed Count 34
Grant Count 36
R01 Count 13
Funding $5,722,775.36
PubMed Score 445.58
PubTator Score 28.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Gene RIF (5)

PMID Text
26621497 study suggests that increased serum TN level is associated with the presence and severity of diseased coronary arteries in patients with stable CAD.
25846370 results predict that a positive TN expression of both tumour tissue and serum points to a more favourable outcome for ovarian cancer patients
16453284 Observational study of gene-disease association. (HuGE Navigator)
15848710 Tetranectin may play an important role in the survival of islets in the liver after islet transplantation.
11962752 analyze the immunohistochemical localization of tetranectin in gastric adenocarcinomas and the adjacent tissues of the wall of the stomach

AA Sequence

MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV      1 - 70
CLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA     71 - 140
EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV            141 - 202
//

Text Mined References (36)

PMID Year Title
26621497 2015 Tetranectin as a Potential Biomarker for Stable Coronary Artery Disease.
25846370 2015 Tetranectin positive expression in tumour tissue leads to longer survival in Danish women with ovarian cancer. Results from the 'Malova' ovarian cancer study.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...