Property Summary

NCBI Gene PubMed Count 37
PubMed Score 462.71
PubTator Score 28.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.2e-38
Disease Target Count Z-score Confidence
Inhalation anthrax 5 3.702 1.9
Cancer 2499 3.021 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 5.2e-38

Gene RIF (7)

AA Sequence

MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV      1 - 70
CLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA     71 - 140
EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV            141 - 202
//

Text Mined References (39)

PMID Year Title