Property Summary

NCBI Gene PubMed Count 85
PubMed Score 788.71
PubTator Score 511.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (52)

AA Sequence

MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSG      1 - 70
NLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSL     71 - 140
TSSTGFQKWKDVPCEDKFSFVCKFKN                                                141 - 166
//

Text Mined References (86)

PMID Year Title