Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.80
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.900 6.9e-05

Gene RIF (2)

AA Sequence

MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEE      1 - 70
PKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINI     71 - 140
KKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDM    141 - 210
EVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPP    211 - 280
TQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTM    281 - 350
GTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR                          351 - 398
//

Text Mined References (25)

PMID Year Title