Property Summary

Ligand Count 23
NCBI Gene PubMed Count 118
PubMed Score 1104.30
PubTator Score 401.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease -1.104 3.1e-03
active ulcerative colitis -1.472 1.2e-03
acute quadriplegic myopathy -2.019 1.3e-05
adult high grade glioma -2.600 1.3e-03
astrocytic glioma -2.900 3.8e-03
Astrocytoma, Pilocytic -2.100 2.1e-04
atypical teratoid / rhabdoid tumor -3.600 8.9e-09
dermatomyositis -1.300 2.2e-03
ependymoma -3.100 5.9e-03
gastric carcinoma -1.200 4.3e-02
glioblastoma -1.900 4.6e-05
group 4 medulloblastoma -2.800 3.1e-04
juvenile dermatomyositis -1.313 5.3e-06
limb girdle muscular dystrophy 2A -1.137 2.4e-03
lung cancer -1.500 1.0e-03
lung carcinoma -2.400 7.2e-10
malignant mesothelioma 5.700 4.9e-10
medulloblastoma, large-cell -3.500 4.3e-04
mucosa-associated lymphoid tissue lympho... 2.619 4.7e-02
oligodendroglioma -2.700 7.0e-03
osteosarcoma -3.073 2.7e-06
Pick disease -1.200 5.6e-04
pituitary cancer 1.100 4.3e-03
primitive neuroectodermal tumor -2.800 7.8e-04
psoriasis -3.000 1.8e-04

Synonym

Accession P05413 B2RAB6 Q5VV93 Q99957
Symbols MDGI
FABP11
H-FABP
M-FABP
O-FABP

Gene

PDB

1G5W   1HMR   1HMS   1HMT   2HMB   3RSW   3WBG   3WVM   3WXQ   4TJZ   4TKB   4TKH   4TKJ   4WBK   5B27   5B28   5B29   5CE4   5HZ9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (93)

AA Sequence

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE      1 - 70
FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA            71 - 133
//

Text Mined References (121)

PMID Year Title