Property Summary

NCBI Gene PubMed Count 108
Grant Count 129
R01 Count 55
Funding $33,956,278.95
PubMed Score 1058.79
PubTator Score 401.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 5.700 0.000
astrocytic glioma -2.900 0.004
ependymoma -3.100 0.006
oligodendroglioma -2.700 0.007
psoriasis -3.000 0.000
glioblastoma -3.200 0.000
osteosarcoma -3.073 0.000
medulloblastoma -3.000 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.800 0.001
juvenile dermatomyositis -1.313 0.000
acute quadriplegic myopathy -2.019 0.000
limb girdle muscular dystrophy 2A -1.137 0.002
lung cancer -3.100 0.000
active Crohn's disease -1.104 0.003
active ulcerative colitis -1.472 0.001
adult high grade glioma -2.600 0.001
pilocytic astrocytoma -2.100 0.000
lung carcinoma -2.400 0.000
Pick disease -1.200 0.001
gastric carcinoma -1.200 0.043
mucosa-associated lymphoid tissue lympho... 2.619 0.047
pituitary cancer 1.100 0.004
dermatomyositis -1.300 0.002

Synonym

Accession P05413 B2RAB6 Q5VV93 Q99957
Symbols MDGI
FABP11
H-FABP
M-FABP
O-FABP

Gene

PDB

1G5W   1HMR   1HMS   1HMT   2HMB   3RSW   3WBG   3WVM   3WXQ   4TJZ   4TKB   4TKH   4TKJ   4WBK   5CE4  

Gene RIF (84)

PMID Text
26484922 This study demonstrated that CSF FABP-3 may be an early marker for later development of dementia.
26212703 Bedside H-FABP measurements may contribute to correct early diagnoses, as its levels are elevated soon following myocardial infarction, and measurement is easy, with a rapid result.
26206228 polymorphism affects fatty acid-binding protein 3 intracellular stability and subcellular localization
26072112 FABP3 was increased in patients with acute heart failure compared to those without.
25830762 Perioperative plasma H-FABP levels may be used for risk stratification of acute kidney injury and mortality following cardiac surgery.
25456730 H-FABP may have a role in occurrence of adverse clinical outcome in pulmonary embolism [meta-analysis]
25234940 Serum H-FABP levels progressively increased from the control group to the OH group.
25212385 Report correlation between preoperative serum h-FABP and the postoperative incidence of acute kidney injury in cardiac surgery patients.
25147067 Elevated H-FABP serum levels in patients with essential hypertension were predictive of future cardiovascular events.
25027319 The frameshift and missense mutations in FABP3, FABP5, and FABP7 genes have been identified in schizophrenia and autism spectrum disorder in humans and in mouse behavioral studies.
More...

AA Sequence

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE      1 - 70
FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA            71 - 133
//

Text Mined References (111)

PMID Year Title
26484922 2016 Cerebrospinal Fluid Fatty Acid-Binding Protein 3 is Related to Dementia Development in a Population-Based Sample of Older Adult Women Followed for 8 Years.
26212703 Comparison of a qualitative measurement of heart-type fatty acid-binding protein with other cardiac markers as an early diagnostic marker in the diagnosis of non-ST-segment elevation myocardial infarction.
26206228 2015 Asp3Gly polymorphism affects fatty acid-binding protein 3 intracellular stability and subcellular localization.
26072112 2015 Ischemic biomarker heart-type fatty acid binding protein (hFABP) in acute heart failure - diagnostic and prognostic insights compared to NT-proBNP and troponin I.
25830762 2015 Perioperative heart-type fatty acid binding protein is associated with acute kidney injury after cardiac surgery.
25456730 2015 Prognostic role of heart-type fatty acid binding protein in pulmonary embolism: a meta-analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25234940 2014 Serum H-FABP levels in patients with hypothyroidism.
25212385 2014 Preoperative serum h-FABP concentration is associated with postoperative incidence of acute kidney injury in patients undergoing cardiac surgery.
25147067 2014 Heart-type fatty acid-binding protein is a novel prognostic marker in patients with essential hypertension.
More...