Property Summary

Ligand Count 55
NCBI Gene PubMed Count 885
PubMed Score 6236.41
PubTator Score 3644.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 6.449 3.2

Expression

  Differential Expression (31)

Disease log2 FC p
acute myeloid leukemia 1.800 2.2e-02
acute quadriplegic myopathy 1.343 1.5e-05
aldosterone-producing adenoma -1.693 1.8e-02
Amyotrophic lateral sclerosis 1.116 3.3e-05
astrocytoma 2.100 2.8e-03
atypical teratoid / rhabdoid tumor -1.100 8.4e-03
Breast cancer -1.300 4.3e-09
breast carcinoma -1.800 3.7e-04
chronic lymphosyte leukemia -1.100 1.5e-03
colon cancer -1.200 4.9e-03
fibroadenoma -1.800 2.4e-02
gastric cancer -2.300 3.2e-04
glioblastoma 1.800 2.1e-03
group 4 medulloblastoma -1.500 1.7e-05
hepatocellular carcinoma -2.400 1.7e-05
intraductal papillary-mucinous adenoma (... -1.100 1.9e-02
lung cancer -1.400 1.1e-04
lung carcinoma -1.200 6.6e-08
malignant mesothelioma -1.500 6.5e-06
medulloblastoma, large-cell -1.100 1.7e-03
nephrosclerosis -1.063 3.0e-05
non-small cell lung cancer -1.257 2.7e-11
ovarian cancer 1.200 1.5e-02
pancreatic cancer -1.600 6.9e-04
pancreatic carcinoma -1.600 6.9e-04
pituitary cancer -1.100 3.2e-02
psoriasis -2.000 1.4e-09
pterygium -1.300 4.6e-02
Rheumatoid arthritis 2.500 1.7e-03
tuberculosis -1.200 6.3e-03
Waldenstrons macroglobulinemia 1.058 1.6e-03

Protein-protein Interaction (2)

Gene RIF (746)

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK      1 - 70
LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGA     71 - 140
GMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHH    141 - 210
LPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARL    211 - 280
EEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF                       281 - 331
//

Text Mined References (901)

PMID Year Title