Property Summary

NCBI Gene PubMed Count 33
PubMed Score 238.15
PubTator Score 78.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.694 8.8e-03
adrenocortical adenoma -1.339 4.6e-02
adult high grade glioma -1.200 1.3e-03
astrocytic glioma -2.800 1.9e-03
atypical teratoid / rhabdoid tumor -3.200 2.2e-03
Breast cancer -1.100 1.1e-03
cystic fibrosis 1.623 8.0e-05
ductal carcinoma in situ 1.700 3.0e-02
ependymoma -4.000 1.5e-02
glioblastoma -1.300 3.6e-04
group 3 medulloblastoma -4.900 6.0e-09
interstitial cystitis 3.600 8.2e-04
interstitial lung disease 2.300 2.8e-02
intraductal papillary-mucinous adenoma (... -2.800 3.9e-02
intraductal papillary-mucinous neoplasm ... -3.200 3.2e-02
lung adenocarcinoma 1.116 2.0e-02
lung cancer 2.100 5.9e-05
lung carcinoma 6.100 3.2e-48
medulloblastoma, large-cell -5.700 6.6e-05
non-small cell lung cancer 2.119 2.9e-12
oligodendroglioma -1.600 1.3e-08
ovarian cancer -4.700 2.1e-09
Pick disease -2.200 8.2e-03
primitive neuroectodermal tumor -2.000 1.1e-02
psoriasis -1.400 3.9e-03
subependymal giant cell astrocytoma -2.274 4.5e-02
tuberculosis -1.200 1.4e-02
ulcerative colitis 1.400 3.9e-06

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVG      1 - 70
PQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEF     71 - 140
SREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKD    141 - 210
PE                                                                        211 - 212
//

Text Mined References (33)

PMID Year Title