Property Summary

NCBI Gene PubMed Count 32
Grant Count 67
R01 Count 49
Funding $5,633,123.31
PubMed Score 233.63
PubTator Score 78.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P05408 P01164 Q6FHD0 Q9BS38
Symbols 7B2
SgV
P7B2
SGNE1

Gene

Gene RIF (12)

PMID Text
25811241 FAM20C plays a role in 7B2-mediated proPC2 activation by phosphorylating residue Thr111; and that 7B2 function is regulated by alternative splicing.
24042052 7B2 chaperones blocked the cytotoxic effects of exogenous hIAPP
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of secretogranin V (SCG5; SGNE1; 7B2 protein) in peptide-treated PBMCs
23172224 data provide insight into novel functions of 7B2 and establish this neural protein as an anti-aggregation chaperone associated with neurodegenerative disease
22947085 conclude that 7B2 is a natively disordered protein whose function as an antiaggregant chaperone is likely facilitated by its lack of appreciable secondary structure and tendency to form oligomers
21901745 the significant effects of SGNE1/7B2 on the growth and apoptosis of glioblastoma cells provide a first proof for a functional implication of SGNE1/7B2 inactivation in the molecular pathology of gliomas.
19058789 Observational study of gene-disease association. (HuGE Navigator)
18448176 Secretogranins V assays failed to detect increased concentrations in any of the patients with neuroendocrine tumours.
17617923 Observational study of gene-disease association. (HuGE Navigator)
17617923 SGNE1 genetic variation does not contribute to obesity and common forms of Type 2 diabetes but may worsen glucose intolerance and insulin resistance, especially in the background of severe and early onset obesity
More...

AA Sequence

MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVG      1 - 70
PQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEF     71 - 140
SREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKD    141 - 210
PE                                                                        211 - 212
//

Text Mined References (32)

PMID Year Title
25811241 2015 Phosphorylation and Alternative Splicing of 7B2 Reduce Prohormone Convertase 2 Activation.
25416956 2014 A proteome-scale map of the human interactome network.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24042052 2013 Blockade of islet amyloid polypeptide fibrillation and cytotoxicity by the secretory chaperones 7B2 and proSAAS.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23172224 2013 The neuroendocrine protein 7B2 suppresses the aggregation of neurodegenerative disease-related proteins.
22947085 2012 The neuroendocrine protein 7B2 is intrinsically disordered.
21901745 2012 Frequent epigenetic inactivation of the chaperone SGNE1/7B2 in human gliomas.
21761138 2012 Meta-analysis of new genome-wide association studies of colorectal cancer risk.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
More...