Property Summary

NCBI Gene PubMed Count 54
PubMed Score 58.48
PubTator Score 26.09

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00186611898525108


  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.700 0.002


Accession P05388 Q3B7A4 Q9BVK4
Symbols P0



4V6X   5AJ0   4V6W  

  Ortholog (10)

Species Source
Macaque OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (12)

26176264 absence of RPLP0, RPLP1, or RPLP2 resulted in reactive oxygen species (ROS) accumulation and MAPK1/ERK2 signaling pathway activation.
25889931 This study shows a spontaneous humoral immune response to ribosomal P0 protein in colorectal cancer patients.
25433997 Down-regulation of RPLP0 resulted in G1 arrest of gastric cancer cells
25307291 the immune response mediated by serum anti-RPLP0 and anti-galectin 3 antibodies plays a key role in the pathogenesis of SLE skin lesions. These findings provide new insights into the mechanism of SLE-related organ disorders.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein P0 (RPLP0) expression by HIV-1 Vpr in Vpr transduced macrophages
23400861 Evaluated autoantibodies against native ribosomal P complex and recombinant ribosomal P proteins (anti-Rib-P0, anti-Rib-P1, anti-Rib-P2) for prevalence, diagnostic relevance&clinical associations in a Chinese cohort with systemic lupus erythematosus.
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein P0 (RPLP0) expression by HIV-1 Vpr in Vpr transduced macrophages
21040949 P proteins are up-regulated in a considerable number of patients with the most common types of cancer.
20705598 Results show that RPL4, RPLP0, and HSPCB were the most stable reference genes in ovarian tissues.
17621266 P0 overexpression may cause tumorigenesis in breast and liver tissues at least in part by inhibiting GCIP-mediated tumor suppression.

AA Sequence

VAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD                                     281 - 317

Text Mined References (61)

PMID Year Title
26176264 2015 Disruption of the ribosomal P complex leads to stress-induced autophagy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889931 2015 Natural humoral immune response to ribosomal P0 protein in colorectal cancer patients.
25433997 2015 Dysregulation of apoptotic signaling pathways by interaction of RPLP0 and cathepsin X/Z in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25307291 2015 Association of anti-acidic ribosomal protein P0 and anti-galectin 3 antibodies with the development of skin lesions in systemic lupus erythematosus.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24658146 2014 Subcellular fractionation and localization studies reveal a direct interaction of the fragile X mental retardation protein (FMRP) with nucleolin.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23400861 2013 Significance of antibodies against the native ribosomal P protein complex and recombinant P0, P1, and P2 proteins in the diagnosis of Chinese patients with systemic lupus erythematosus.