Property Summary

NCBI Gene PubMed Count 54
PubMed Score 60.11
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.9e-03
Disease Target Count Z-score Confidence
Charcot-Marie-Tooth disease axonal type 2L 5 3.699 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.700 1.9e-03

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE      1 - 70
NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA     71 - 140
LGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEET    141 - 210
LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAP    211 - 280
VAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD                                     281 - 317
//

Text Mined References (62)

PMID Year Title