Property Summary

NCBI Gene PubMed Count 42
PubMed Score 30.66
PubTator Score 1040.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 2.6e-30
intraductal papillary-mucinous neoplasm ... -1.700 1.2e-03
medulloblastoma, large-cell 1.100 1.7e-04
Multiple myeloma 1.763 5.9e-03
oligodendroglioma 1.500 3.9e-02
ovarian cancer -1.100 3.9e-04
sonic hedgehog group medulloblastoma 1.100 4.1e-06
Waldenstrons macroglobulinemia 1.328 3.4e-02

Synonym

Accession P05387 Q6FG96
Symbols P2
LP2
RPP2
D11S2243E

Gene

PDB

4V6X   2LBF   4BEH   1S4J   2JDL   2W1O   5DDZ   5GU4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA      1 - 70
VAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD                              71 - 115
//

Text Mined References (58)

PMID Year Title