Property Summary

NCBI Gene PubMed Count 41
Grant Count 5
R01 Count 5
Funding $1,045,997
PubMed Score 29.78
PubTator Score 1040.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P05387 Q6FG96
Symbols P2
LP2
RPP2
D11S2243E

Gene

PDB

4V6X   2LBF   4BEH   1S4J   2JDL   2W1O   5DDZ  

Gene RIF (13)

PMID Text
26176264 absence of RPLP0, RPLP1, or RPLP2 resulted in reactive oxygen species (ROS) accumulation and MAPK1/ERK2 signaling pathway activation.
25412900 Results show that the conserved C-terminal segment of P2 from three different eukaryotic species- Human, Plasmodium falciparum and Toxoplasma gondii is intrinsically disordered.
23400861 Evaluated autoantibodies against native ribosomal P complex and recombinant ribosomal P proteins (anti-Rib-P0, anti-Rib-P1, anti-Rib-P2) for prevalence, diagnostic relevance&clinical associations in a Chinese cohort with systemic lupus erythematosus.
22909382 Data show that ricin A-chain (RTA) interacts directly with recombinant P1-P2 dimer, indicating the importance of P1 and P2 in enabling RTA to bind and depurinate ribosomes.
21410706 relevance of the observed cross-reactive IgE autoantibodies against P2 proteins in systemic lupus eryth remains to be elucidated
21040949 P proteins are up-regulated in a considerable number of patients with the most common types of cancer.
20385603 the eukaryotic stalk protein P2 forms a symmetric homodimer in solution, and is structurally distinct from the bacterial counterpart L12 homodimer.
18675807 These results support the hypothesis that at least some of the changes in the profile of newly synthesized proteins detected in cells deprived of P1 and P2 proteins might be due to an effect on the efficiency of cap-independent translation.
18422483 Data indicate that P1/P2 proteins modulate cytoplasmic translation by influencing the interaction between subunits, thereby regulating the rate of cell proliferation.
16920697 Distinct roles for CD39 and P2-purinergic signaling in both tissue remodeling and fibrogenesis with respect to human pancreatic diseases.
More...

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA      1 - 70
VAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD                              71 - 115
//

Text Mined References (56)

PMID Year Title
26176264 2015 Disruption of the ribosomal P complex leads to stress-induced autophagy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25412900 2014 The C-terminal domain of eukaryotic acidic ribosomal P2 proteins is intrinsically disordered with conserved structural propensities.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23400861 2013 Significance of antibodies against the native ribosomal P protein complex and recombinant P0, P1, and P2 proteins in the diagnosis of Chinese patients with systemic lupus erythematosus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22909382 2012 The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells.
22135285 2012 Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex.
More...