Property Summary

NCBI Gene PubMed Count 42
PubMed Score 30.66
PubTator Score 1040.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 2.6e-30
intraductal papillary-mucinous neoplasm ... -1.700 1.2e-03
medulloblastoma, large-cell 1.100 1.7e-04
Multiple myeloma 1.763 5.9e-03
oligodendroglioma 1.500 3.9e-02
ovarian cancer -1.100 3.9e-04
sonic hedgehog group medulloblastoma 1.100 4.1e-06
Waldenstrons macroglobulinemia 1.328 3.4e-02

Gene RIF (14)

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA      1 - 70
VAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD                              71 - 115
//

Text Mined References (58)

PMID Year Title