Property Summary

NCBI Gene PubMed Count 36
PubMed Score 29.78
PubTator Score 90.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P05386 A6NIB2
Symbols P1
LP1
RPP1

Gene

PDB

4V6X   2LBF   4BEH  

Gene RIF (7)

PMID Text
26176264 absence of RPLP0, RPLP1, or RPLP2 resulted in reactive oxygen species (ROS) accumulation and MAPK1/ERK2 signaling pathway activation.
23400861 Evaluated autoantibodies against native ribosomal P complex and recombinant ribosomal P proteins (anti-Rib-P0, anti-Rib-P1, anti-Rib-P2) for prevalence, diagnostic relevance&clinical associations in a Chinese cohort with systemic lupus erythematosus.
22909382 Data show that ricin A-chain (RTA) interacts directly with recombinant P1-P2 dimer, indicating the importance of P1 and P2 in enabling RTA to bind and depurinate ribosomes.
21040949 P proteins are up-regulated in a considerable number of patients with the most common types of cancer.
18675807 These results support the hypothesis that at least some of the changes in the profile of newly synthesized proteins detected in cells deprived of P1 and P2 proteins might be due to an effect on the efficiency of cap-independent translation.
18422483 Data indicate that P1/P2 proteins modulate cytoplasmic translation by influencing the interaction between subunits, thereby regulating the rate of cell proliferation.
12479870 the P1 and P2 proteins are not actively transported into the nucleus compartment, remaining predominantly in the cytoplasm (the perinuclear compartment).

AA Sequence

MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAP      1 - 70
AAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD                               71 - 114
//

Text Mined References (42)

PMID Year Title
26176264 2015 Disruption of the ribosomal P complex leads to stress-induced autophagy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23400861 2013 Significance of antibodies against the native ribosomal P protein complex and recombinant P0, P1, and P2 proteins in the diagnosis of Chinese patients with systemic lupus erythematosus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22909382 2012 The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22135285 2012 Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex.
More...