Property Summary

NCBI Gene PubMed Count 36
PubMed Score 30.66
PubTator Score 90.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (7)

AA Sequence

MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAP      1 - 70
AAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD                               71 - 114
//

Text Mined References (43)

PMID Year Title