Property Summary

Ligand Count 43
NCBI Gene PubMed Count 200
PubMed Score 1645.94
PubTator Score 745.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.900 1.1e-06
Breast cancer -2.500 1.0e-33
breast carcinoma -1.400 1.5e-34
cystic fibrosis -2.225 4.8e-06
Down syndrome 1.100 2.4e-03
ductal carcinoma in situ -1.100 4.1e-03
ependymoma -1.300 2.8e-03
group 3 medulloblastoma -3.800 4.2e-06
invasive ductal carcinoma -1.200 1.7e-02
lung carcinoma 1.100 3.5e-15
malignant mesothelioma -4.200 6.2e-09
medulloblastoma, large-cell -3.000 9.8e-06
osteosarcoma 1.078 7.7e-03
ovarian cancer -1.700 9.3e-17
pituitary cancer -1.700 6.8e-04
primitive neuroectodermal tumor -1.700 7.8e-03

Synonym

Accession P05230 B2R5T0 D3DQF2 P07502 Q16588 FGF-1
Symbols AFGF
ECGF
FGFA
ECGFA
ECGFB
FGF-1
HBGF1
HBGF-1
GLIO703
ECGF-beta
FGF-alpha

Gene

PANTHER Protein Class (2)

PDB

1EVT   3OJV   1QCT   2K4A   2KI6   1RY7   1DJS   1E0O   3CU1   3OJ2   3OJM   4J23   2KI4   1AXM   1DZC   1DZD   1HKN   1JQZ   1JT3   1JT4   1JT5   1JT7   1JTC   1JY0   1K5U   1K5V   1M16   1NZK   1P63   1PZZ   1Q03   1Q04   1RG8   1RML   1YTO   1Z2V   1Z4S   2AFG   2AQZ   2AXM   2ERM   2HW9   2HWA   2HWM   2HZ9   2K43   2K8R   2NTD   2Q9X   2RQ9   3B9U   3BA4   3BA5   3BA7   3BAD   3BAG   3BAH   3BAO   3BAQ   3BAU   3BAV   3BB2   3CQA   3CRG   3CRH   3CRI   3FGM   3FJ8   3FJ9   3FJA   3FJB   3FJC   3FJD   3FJE   3FJF   3FJH   3FJI   3FJJ   3FJK   3HOM   3JUT   3K1X   3O3Q   3UD7   3UD8   3UD9   3UDA   4Q91   4Q9G   4Q9P   4QAL   4QBC   4QBV   4QC4   4QO3   4XKI   4YOL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (135)

AA Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY      1 - 70
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY     71 - 140
GQKAILFLPLPVSSD                                                           141 - 155
//

Text Mined References (206)

PMID Year Title