Property Summary

NCBI Gene PubMed Count 188
Grant Count 368
R01 Count 257
Funding $35,135,734.08
PubMed Score 1583.18
PubTator Score 745.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
osteosarcoma 1.078 0.008
ependymoma -1.600 0.000
group 3 medulloblastoma -3.800 0.000
cystic fibrosis -2.225 0.000
atypical teratoid/rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.700 0.008
lung carcinoma 1.100 0.000
breast carcinoma -1.400 0.000
Breast cancer -2.500 0.000
ductal carcinoma in situ -1.100 0.004
invasive ductal carcinoma -1.600 0.023
ovarian cancer -3.800 0.000
pituitary cancer -1.700 0.001
Down syndrome 1.300 0.008

Synonym

Accession P05230 B2R5T0 D3DQF2 P07502 Q16588 FGF-1
Symbols AFGF
ECGF
FGFA
ECGFA
ECGFB
FGF-1
HBGF1
HBGF-1
GLIO703
ECGF-beta
FGF-alpha

Gene

PANTHER Protein Class (2)

PDB

1EVT   3OJV   1QCT   2K4A   2KI6   1RY7   1DJS   1E0O   3CU1   3OJ2   3OJM   4J23   2KI4   1AXM   1DZC   1DZD   1HKN   1JQZ   1JT3   1JT4   1JT5   1JT7   1JTC   1JY0   1K5U   1K5V   1M16   1NZK   1P63   1PZZ   1Q03   1Q04   1RG8   1RML   1YTO   1Z2V   1Z4S   2AFG   2AQZ   2AXM   2ERM   2HW9   2HWA   2HWM   2HZ9   2K43   2K8R   2NTD   2Q9X   2RQ9   3B9U   3BA4   3BA5   3BA7   3BAD   3BAG   3BAH   3BAO   3BAQ   3BAU   3BAV   3BB2   3CQA   3CRG   3CRH   3CRI   3FGM   3FJ8   3FJ9   3FJA   3FJB   3FJC   3FJD   3FJE   3FJF   3FJH   3FJI   3FJJ   3FJK   3HOM   3JUT   3K1X   3O3Q   3UD7   3UD8   3UD9   3UDA   4Q91   4Q9G   4Q9P   4QAL   4QBC   4QBV   4QC4   4QO3   4XKI   4YOL  

 GWAS Trait (1)

Gene RIF (123)

PMID Text
26840910 The role of intracellular FGF1 is to protect the cell against stress conditions by providing an additional signal for cell survival, independently of receptor-activated signaling cascades.
26836284 Data suggest folding of FGF1 is critical for its nonclassical secretion via permeability of lipid bilayer; mutation of proline135 in C-terminus of FGF1 leads to partial unfolding/decrease in FGF1's ability to permeabilize phosphatidylserine bilayers.
26420862 expression of human FGF1 solely in beta-cells in fgf1(-/-) animals prevented overnutrition induced compensatory beta-cell differentiation.
26400350 FGF-1 synthesis and secretion by synovial fibroblasts were significantly increased in osteoarthritis.
26391572 These findings suggest that the presence of FGF1 may serve as a prognostic indicator and a potential therapeutic target for non-small cell lung cancer patients, especially for lung squamous cell carcinoma.
26365194 The analysis identified a signaling axis between FGF signaling and the transcription factor Sox1, which is preferentially expressed in stem- and mesenchymal-like breast cancers.
26362179 FGF1-FGFR1 axis promotes tongue squamous cell carcinoma metastasis through the epithelial-mesenchymal transition pathway
26138239 FGF1 expression is increased in lung from idiopathic pulmonary fibrosis patients.
26109071 p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3.
25589163 Study presents a transcript profiling of remyelinated multiple sclerosis lesions and identified FGF1 as a promoter of remyelination
More...

AA Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY      1 - 70
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY     71 - 140
GQKAILFLPLPVSSD                                                           141 - 155
//

Text Mined References (194)

PMID Year Title
26840910 2016 Identification of new FGF1 binding partners-Implications for its intracellular function.
26836284 2016 Folding of Fibroblast Growth Factor 1 Is Critical for Its Nonclassical Release.
26420862 2016 FGF1 Mediates Overnutrition-Induced Compensatory ?-Cell Differentiation.
26400350 2015 Upregulation of fibroblast growth factor 1 in the synovial membranes of patients with late stage osteoarthritis.
26391572 2015 Clinicopathological significance of fibroblast growth factor 1 in non-small cell lung cancer.
26365194 2015 Sox10 Regulates Stem/Progenitor and Mesenchymal Cell States in Mammary Epithelial Cells.
26362179 2015 FGF1-FGFR1 axis promotes tongue squamous cell carcinoma (TSCC) metastasis through epithelial-mesenchymal transition (EMT).
26138239 2015 Increased FGF1-FGFRc expression in idiopathic pulmonary fibrosis.
26109071 2015 RasGAP Shields Akt from Deactivating Phosphatases in Fibroblast Growth Factor Signaling but Loses This Ability Once Cleaved by Caspase-3.
25589163 2014 Transcript profiling of different types of multiple sclerosis lesions yields FGF1 as a promoter of remyelination.
More...