Property Summary

Ligand Count 43
NCBI Gene PubMed Count 200
PubMed Score 1645.94
PubTator Score 745.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.900 1.1e-06
Breast cancer -2.500 1.0e-33
breast carcinoma -1.400 1.5e-34
cystic fibrosis -2.225 4.8e-06
Down syndrome 1.100 2.4e-03
ductal carcinoma in situ -1.100 4.1e-03
ependymoma -1.300 2.8e-03
group 3 medulloblastoma -3.800 4.2e-06
invasive ductal carcinoma -1.200 1.7e-02
lung carcinoma 1.100 3.5e-15
malignant mesothelioma -4.200 6.2e-09
medulloblastoma, large-cell -3.000 9.8e-06
osteosarcoma 1.078 7.7e-03
ovarian cancer -1.700 9.3e-17
pituitary cancer -1.700 6.8e-04
primitive neuroectodermal tumor -1.700 7.8e-03

Protein-protein Interaction (9)

PDB (97)

Gene RIF (135)

AA Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY      1 - 70
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY     71 - 140
GQKAILFLPLPVSSD                                                           141 - 155
//

Text Mined References (206)

PMID Year Title