Property Summary

NCBI Gene PubMed Count 176
PubMed Score 643.46
PubTator Score 299.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.102 3.2e-02
Breast cancer 3.100 2.5e-02
gastric cancer 1.600 2.4e-02
hepatocellular carcinoma 1.600 7.2e-04
lung cancer 1.400 1.6e-03
Multiple myeloma 1.188 1.7e-03
ovarian cancer -1.300 6.2e-05
pancreatic cancer 2.100 9.5e-03
pancreatic carcinoma 2.100 9.5e-03
psoriasis -1.900 6.3e-05

Gene RIF (127)

AA Sequence

MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC      1 - 70
VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD     71 - 140
KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE    141 - 210
ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD    211 - 280
TDETELARQMERLERENAEVDGDDDAEEMEAKAED                                       281 - 315
//

Text Mined References (184)

PMID Year Title