Property Summary

NCBI Gene PubMed Count 164
Grant Count 146
R01 Count 125
Funding $13,558,373.88
PubMed Score 642.88
PubTator Score 299.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.102 0.032
gastric cancer 1.600 0.024
hepatocellular carcinoma 1.600 0.001
pancreatic cancer 2.100 0.010
Multiple myeloma 1.188 0.002
psoriasis -1.900 0.000
lung cancer 1.400 0.002
Breast cancer 3.100 0.025
pancreatic carcinoma 2.100 0.010
ovarian cancer 1.800 0.000

Synonym

Accession P05198
Symbols EIF2
EIF-2
EIF2A
EIF-2A
EIF-2alpha

Gene

PDB

1KL9   1Q8K  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1388 screening 0 / 0 / 11 Determination of inhibition of thapsigargin-initiated eIF2 alpha phosphorylation in ER stress signaling.

Gene RIF (116)

PMID Text
26742780 The reactive oxygen species-generating NADPH oxidase-4 (Nox4) is induced downstream of ATF4, binds to a PP1-targeting subunit GADD34 at the endoplasmic reticulum, and inhibits PP1 activity to increase eIF2alpha phosphorylation and ATF4 levels.
26717981 a delay in eIF2-bound GTP hydrolysis should occur. In this work, we reconstructed this situation and found that such a delay leads to the redistribution of initiation complexes in favor to downstream AUG codons.
26283179 Our work suggests that OLA1 is a novel translational GTPase and plays a suppressive role in translation and cell survival, as well as cancer growth and progression.
26100893 Data indicate that protein phosphatase 1 subunit GADD34 directly interacts with eukaryotic translation initiation factor 2 subunit alpha (eIF2alpha).
25899421 Classical swine fever virus (CSFV) infection increased the phosphorylation of eukaryotic translation initiation factor (eIF)2alpha and its kinase PKR. The activation of PKR during CSFV infection is beneficial to the virus.
25807820 These findings provide evidence for a pro-survival role of PERK-eIF2alpha phosphorylation arm that contributes to chronic myelogenous leukemia progression and development of imatinib resistance.
25774599 localised G-actin depletion at sites enriched for PPP1R15 enhanced eIF2alpha phosphorylation.
25762631 BRCA1 is upregulated by depletion of the eIF2.GTP.Met-tRNAi translation initiation complex
25759478 GCN2 activation and phosphorylation of eIF2alpha in response to mTORC1 inhibition are necessary for autophagy.
25621764 a single uORF is sufficient for eIF2-mediated translation control.
More...

AA Sequence

MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC      1 - 70
VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD     71 - 140
KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE    141 - 210
ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD    211 - 280
TDETELARQMERLERENAEVDGDDDAEEMEAKAED                                       281 - 315
//

Text Mined References (172)

PMID Year Title
26742780 2016 Targeted redox inhibition of protein phosphatase 1 by Nox4 regulates eIF2?-mediated stress signaling.
26717981 2016 Sliding of a 43S ribosomal complex from the recognized AUG codon triggered by a delay in eIF2-bound GTP hydrolysis.
26283179 2015 OLA1 regulates protein synthesis and integrated stress response by inhibiting eIF2 ternary complex formation.
26100893 2015 An eIF2?-binding motif in protein phosphatase 1 subunit GADD34 and its viral orthologs is required to promote dephosphorylation of eIF2?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25899421 2015 PKR activation enhances replication of classical swine fever virus in PK-15 cells.
25807820 2014 [Pro-survival signaling pathways activated by BCR-ABL oncogene in chronic myelogenous leukemia cells: the role of the perk-EIF2? signal path and acetylation of p53].
25774599 2015 Actin dynamics tune the integrated stress response by regulating eukaryotic initiation factor 2? dephosphorylation.
25762631 2015 Depletion of eIF2·GTP·Met-tRNAi translation initiation complex up-regulates BRCA1 expression in vitro and in vivo.
25759478 2015 Phosphorylation of eIF2? triggered by mTORC1 inhibition and PP6C activation is required for autophagy and is aberrant in PP6C-mutated melanoma.
More...