Property Summary

NCBI Gene PubMed Count 68
Grant Count 15
R01 Count 7
Funding $2,646,769
PubMed Score 484.69
PubTator Score 3112.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 3.800 0.000
ovarian cancer 1.200 0.014

Gene RIF (34)

PMID Text
25409280 Quantum-mechanical computational methods were employed to study the catalytic mechanism of human placental AP (PLAP). An active-site model was used, constructed on the basis of the X-ray crystal structure of the enzyme.
24856042 term placental explants, but not their conditioned medium, can de-phosphorylate IGFBP-1 through the action of placental alkaline phosphatase
24296104 A candidate gene, ALPP, encoding the placental alkaline phosphatase, was identified as being potentially involved in recurrent spontaneous abortion.
24247025 Anti-PLAP antibodies may serve as a modular building blocks for the development of targeted therapeutic products, armed with cytotoxic drugs, radionuclides or cytokines as payloads.
24043717 The objective of the following study was to record the specificity and sensitivity of alpha5(IV) loss, smoothelin expression and PLAP expression as markers of gastrointestinal smooth muscle neoplasms
24019514 Data indicate that p180 is required for the efficient targeting of placental alkaline phosphatase (ALPP) mRNA to the endoplasmic reticulum (ER).
22333159 High serum alkaline phosphatase cooperating with MMP-9 is associated with metastasis in patients with primary osteosarcoma.
22190034 HIV-1 IN is identified to have a physical interaction with alkaline phosphatase, placental (ALPP; PLAP) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21939286 the catalytic mechanism of human placental alkaline phosphatase
21910833 Calculation of the electrostatic potentials within the active site of human placental alkaline phosphatase also suggests that the local positive electrostatic environment may account for its capability to distinguish various substrates
More...

AA Sequence

MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST      1 - 70
VTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARF     71 - 140
NQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIAT    141 - 210
QLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL    211 - 280
DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL    281 - 350
TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG    351 - 420
YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACL    421 - 490
EPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP                             491 - 535
//

Text Mined References (69)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25409280 2014 Catalytic activity of human placental alkaline phosphatase (PLAP): insights from a computational study.
24856042 2014 Placental alkaline phosphatase de-phosphorylates insulin-like growth factor (IGF)-binding protein-1.
24296104 2014 Polymorphisms of human placental alkaline phosphatase are associated with in vitro fertilization success and recurrent pregnancy loss.
24247025 A human monoclonal antibody specific to placental alkaline phosphatase, a marker of ovarian cancer.
24043717 2014 A study of ?5 chain of collagen IV, caldesmon, placental alkaline phosphatase and smoothelin as immunohistochemical markers of gastrointestinal smooth muscle neoplasms.
24019514 2013 Identification of a region within the placental alkaline phosphatase mRNA that mediates p180-dependent targeting to the endoplasmic reticulum.
22333159 2012 High serum alkaline phosphatase cooperating with MMP-9 predicts metastasis and poor prognosis in patients with primary osteosarcoma in Southern China.
21939286 2011 Computational modeling of the catalytic mechanism of human placental alkaline phosphatase (PLAP).
21910833 2011 Human placental alkaline phosphatase-mediated hydrolysis correlates tightly with the electrostatic contribution from tail group.
More...