Property Summary

NCBI Gene PubMed Count 203
Grant Count 48
R01 Count 30
Funding $8,193,284.15
PubMed Score 493.84
PubTator Score 273.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis -2.364 0.000
non-small cell lung cancer -1.538 0.000
lung cancer -1.200 0.035
sarcoidosis -1.800 0.015
lung adenocarcinoma -1.300 0.000
posterior fossa group B ependymoma -1.100 0.000
lung carcinoma -2.900 0.000
axial spondyloarthropathy 1.500 0.036
psoriasis 1.200 0.000

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
518 confirmatory 54 / 0 / 64340 TNAP luminescent HTS assay
614 screening 0 / 0 / 20540 HTS colorimetric detection of phosphate released in TNAP reaction
615 screening 0 / 0 / 20540 HTS colorimetric detection of p-nitrophenol released in TNAP reaction
813 screening 8 / 0 / 64386 HTS identification of compounds activating TNAP at intermediate concentration of phosphate acceptor detected in luminescent assay
1001 confirmatory 51 / 0 / 195581 uHTS identification of compounds activating TNAP in the absence of phosphate acceptor performed in luminescent assay
1012 screening 518 / 0 / 195116 uHTS identification of TNAP inhibitors in the absence of phosphate acceptor performed in luminescent assay
1056 confirmatory 226 / 0 / 259 SAR analysis of an In Vitro TNAP Dose Response Luminescent Assay
1135 screening 66 / 0 / 195558 uHTS identification of compounds inhibiting TNAP at a high concentration of phosphate acceptor detected in a luminescent assay
1136 screening 5 / 0 / 195619 uHTS identification of compounds activating TNAP at a high concentration of phosphate acceptor detected in a luminescent assay
1450 confirmatory 36 / 0 / 3 SAR assay for compounds activating TNAP in the absence of phosphate acceptor performed in a luminescent assay
More...

Gene RIF (147)

PMID Text
26797772 Analysis of a series of multiple N-glycan depletion mutants in TNSALP revealed that three N-glycans on N230, N271 and N303 were the minimal requirement for the structure and function of TNSALP and a prerequisite for its stable expression in a cell.
26645431 glycosylation differences in human bone alkaline phosphatases are of crucial importance for protein-protein interactions with collagen type I
26389140 The presence of TNAP increased the dynamics and decreased the ordering of model membranes.
26219720 these data demonstrate that TNAP activity is significantly increased in the brain in both the sporadic and familial forms of Alzheimer's Disease (AD) and that TNAP activity is significantly increased in the plasma in AD patients
25853240 ALP quartiles were significantly associated with albuminuria in participants with estimated glomerular filtration rate>120 90-119, 60-89 and <60 mL/min/1.73 Higher ALP levels are significantly associated with renal hyperfiltration
25775211 during skeletal mineralization, the building Ca2+ gradient first activates TNAP, but gradually inactivates it at high Ca2+ concentrations, toward completion of mineralization.
25769592 Two-month alkaline phosphatase of <100 U/L had a negative predictive value of 97% for development of ischemic cholangiopathy after liver transplantation.
25636587 These data confirm that TNAP is co-expressed by dental pulp stromal cells together with other bone marrow stromal cells markers and show that cell density affects TNAP expression levels.
25603770 In inflammatory cholestatic conditions, loss of activity of liver AP might promote hyper-adenosine triphosphate-bilia, lipopolysaccharide overload, and subsequent exacerbation and perpetuation of inflammation. [review]
25536665 ALP mRNA binds to and is stabilized by vimentin.
More...

AA Sequence

MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAA      1 - 70
RILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN     71 - 140
TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH    141 - 210
NIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDP    211 - 280
HNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALH    281 - 350
EAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG    351 - 420
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACI    421 - 490
GANLGHCAPASSAGSLAAGPLLLALALYPLSVLF                                        491 - 524
//

Text Mined References (209)

PMID Year Title
26797772 2016 Glycosylation-deficient mutations in tissue-nonspecific alkaline phosphatase impair its structure and function and are linked to infantile hypophosphatasia.
26645431 2016 Glycation Contributes to Interaction Between Human Bone Alkaline Phosphatase and Collagen Type I.
26389140 2015 Effects of GPI-anchored TNAP on the dynamic structure of model membranes.
26219720 2015 The Role of Tissue Non-specific Alkaline Phosphatase (TNAP) in Neurodegenerative Diseases: Alzheimer's Disease in the Focus.
25982064 2015 Molecular phenotype of tissue-nonspecific alkaline phosphatase with a proline (108) to leucine substitution associated with dominant odontohypophosphatasia.
25853240 2015 Associations between renal hyperfiltration and serum alkaline phosphatase.
25775211 2015 Functional significance of calcium binding to tissue-nonspecific alkaline phosphatase.
25769592 2015 Serum alkaline phosphatase and bilirubin are early surrogate markers for ischemic cholangiopathy and graft failure in liver transplantation from donation after circulatory death.
25636587 2015 Tissue non-specific alkaline phosphatase production by human dental pulp stromal cells is enhanced by high density cell culture.
25603770 2015 Liver alkaline phosphatase: a missing link between choleresis and biliary inflammation.
More...