Property Summary

NCBI Gene PubMed Count 612
PubMed Score 2667.81
PubTator Score 1508.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.200 9.1e-03
Astrocytoma, Pilocytic -1.300 1.0e-05
atypical teratoid / rhabdoid tumor -1.100 4.4e-03
ependymoma -1.300 1.3e-08
glioblastoma -1.200 1.1e-06
group 3 medulloblastoma -1.700 5.6e-03
intraductal papillary-mucinous adenoma (... -1.300 1.8e-02
intraductal papillary-mucinous carcinoma... -1.900 3.8e-03
intraductal papillary-mucinous neoplasm ... -1.800 2.6e-02
lung cancer -2.300 1.2e-02
lung carcinoma 1.200 2.3e-24
medulloblastoma, large-cell -1.300 2.2e-02
nasopharyngeal carcinoma -1.600 4.4e-07
osteosarcoma -1.449 4.8e-06
pancreatic ductal adenocarcinoma liver m... -4.655 1.1e-02
Pick disease -1.100 5.2e-06
primitive neuroectodermal tumor -1.600 1.2e-02
psoriasis 1.100 2.8e-02

Protein-protein Interaction (2)

Gene RIF (647)

AA Sequence

MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTL      1 - 70
YVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGK     71 - 140
QGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLL    141 - 210
STPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSA    211 - 280
ERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYM    281 - 350
DAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK    351 - 420
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVI    421 - 490
PRS                                                                       491 - 493
//

Text Mined References (616)

PMID Year Title