Property Summary

NCBI Gene PubMed Count 590
Grant Count 554
R01 Count 297
Funding $69,338,206.36
PubMed Score 2573.01
PubTator Score 1508.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P05181 Q5VZD5 Q6NWT9 Q9UK47
Symbols CPE1
CYP2E
P450-J
P450C2E

Gene

PDB

3E4E   3E6I   3GPH   3KOH   3LC4   3T3Z  

 GWAS Trait (1)

Gene RIF (626)

PMID Text
26970898 rs915906 polymorphism associated with semen quality and internal levels of exposure to trihalomethanes
26926595 MiR-552 with mutations in non-seed region losses its transcriptional, but retains its post-transcriptional repression to CYP2E1. In contrast, mutation in miR-552 seed sequence suppresses its inhibitory effects on CYP2E1 expression at protein
26848198 the combination of genotypes ADH2 * 2, CYP2E1 * 1 combined with genotype homozygous ALDH2 * 1 found in this study could be leading to the population to a potential risk to alcoholism.
26823792 This meta-analysis suggests that the CYP2E1 RsaI/PstI polymorphisms are a risk factor for developing oral cancer
26782431 polymorphisms in CYP2E1 (PstI) and CYP1A1 (MspI) were not associated with sporadic colorectal cancer in the evaluated Brazilian population.
26582733 results confirm the results reported in other populations and emphasize the importance of the involvement of this gene in the development of detoxification of the NPC, which seems more and more strongly associated with environmental factors.
26497211 Data indicate that alcohol induces not only pathological but also protective mechanisms in steatotic hepatocytes via CYP2E1.
26373042 variant alleles in the NEIL2 (rs804270), APE1 (rs2275008), CYP2E1 (rs2031920) and MDM2 (rs2279744) SNPs may independently influence susceptibility to gastric cancer in a Northern Jiangsu Chinese population.
26252103 Single nucleotide polymorphisms of CYP2C8,CYP2E1 and CYP4B1 are associated with susceptibility to gout in ethnic Han males population.
26199425 SNP in 3'-UTR of CYP2E1 affects binding of miRNA to modulate the expression in liver.
More...

AA Sequence

MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTL      1 - 70
YVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGK     71 - 140
QGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLL    141 - 210
STPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSA    211 - 280
ERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYM    281 - 350
DAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK    351 - 420
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVI    421 - 490
PRS                                                                       491 - 493
//

Text Mined References (594)

PMID Year Title
26970898 2016 Interactions between CYP2E1, GSTZ1 and GSTT1 polymorphisms and exposure to drinking water trihalomethanes and their association with semen quality.
26926595 2016 A dual inhibition: microRNA-552 suppresses both transcription and translation of cytochrome P450 2E1.
26848198 2015 Characterization of polymorphisms of genes ADH2, ADH3, ALDH2 and CYP2E1 and relationship to the alcoholism in a Colombian population.
26823792 2015 CYP2E1 RsaI/PstI polymorphisms contributed to oral cancer susceptibility: a meta-analysis.
26782431 2015 A case-control study of CYP2E1 (PstI) and CYP1A1 (MspI) polymorphisms in colorectal cancer.
26582733 2015 [Genetic polymorphism of cytochrome P450 2E1 and the risk of nasopharyngeal carcinoma].
26497211 2015 Identification of cytochrome CYP2E1 as critical mediator of synergistic effects of alcohol and cellular lipid accumulation in hepatocytes in vitro.
26373042 2015 Polymorphisms in NEIL-2, APE-1, CYP2E1 and MDM2 Genes are Independent Predictors of Gastric Cancer Risk in a Northern Jiangsu Population (China).
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
26199425 2015 Single-Nucleotide Polymorphisms in Cytochrome P450 2E1 (CYP2E1) 3'-Untranslated Region Affect the Regulation of CYP2E1 by miR-570.
More...