Property Summary

NCBI Gene PubMed Count 415
Grant Count 260
R01 Count 179
Funding $23,166,757.85
PubMed Score 2022.49
PubTator Score 1808.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.197 0.000
medulloblastoma, large-cell 1.200 0.002
ovarian cancer -1.400 0.000
psoriasis -4.700 0.000

Synonym

Accession P05177 Q16754 Q6NWU5 Q9BXX7 Q9UK49
Symbols CP12
P3-450
P450(PA)

Gene

PANTHER Protein Class (2)

PDB

2HI4  

 GWAS Trait (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
410 confirmatory 4446 / 733 / 4019 p450-cyp1a2
1851 other 0 / 0 / 0 Cytochrome panel assay with activity outcomes
652076 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: LCMS-based biochemical cytochrome P450 inhibition assay
743029 other 1 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of vasopressin receptor 1a (V1a-R): LCMS-based biochemical cytochrome P450 inhibition assay

Gene RIF (427)

PMID Text
27093553 CYP1A2 metabolizes E2 to generate the potent anti-tumor agent 2-ME in HCC.
26865042 This large meta-analysis suggests no significant effect of the investigated CYP1A2 SNPs on cancer overall risk under various genetic models
26643992 Pregnane X receptor likely regulates CYP1A2 expression in 3D spheroids of liver cancer cells.
26588584 CYP rs2470890 allele 'C' showed an association with T2DM only when the interaction with coffee was considered, thereby setting an example of genetic activation by dietary changes associating with metabolic syndrome.
26582657 Dietary tocopherols inhibit PhIP-induced prostate carcinogenesis in CYP1A2-humanized transgenic mice.
26551865 For the computed CYP 1A2 binding affinities, the model showed a root mean square error of 4.1 kJ mol-1 and a standard error in prediction in cross-validation of 4.3 kJ mol-1.
26530626 The results of this study suggest that the CYP1A2*1F polymorphism is associated with super-refractory schizophrenia.
26514519 CYP1A2 rs762551 polymorphism is a protective factor for bladder cancer.
26098700 phenotypic association studies in population in Nigeria: Data suggest polymorphisms in CYP1A2 exist in the population studied; distribution of CYP1A2 activity is bimodal; influence of age/sex on activity are not significant in this biomarker study.
26068521 niclosamide was subjected to efficient metabolic reactions hydroxylation and glucuronidation, wherein CYP1A2 and UGT1A1 were the main contributing enzymes, respectively.
More...

AA Sequence

MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQ      1 - 70
RYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLA     71 - 140
QNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFP    141 - 210
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSV    211 - 280
RDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTV    281 - 350
IGRERRPRLSDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL    351 - 420
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGVKVD    421 - 490
LTPIYGLTMKHARCEHVQARRFSIN                                                 491 - 515
//

Text Mined References (419)

PMID Year Title
27093553 2016 Cytochrome P450 1A2 Metabolizes 17?-Estradiol to Suppress Hepatocellular Carcinoma.
26865042 2016 Lack of association between polymorphisms in the CYP1A2 gene and risk of cancer: evidence from meta-analyses.
26643992 2015 CYP1A1 and CYP1A2 expression levels are differentially regulated in three-dimensional spheroids of liver cancer cells compared to two-dimensional monolayer cultures.
26588584 2016 Caffeine Impact on Metabolic Syndrome Components Is Modulated by a CYP1A2 Variant.
26582657 2016 Dietary tocopherols inhibit PhIP-induced prostate carcinogenesis in CYP1A-humanized mice.
26551865 2015 Linear Interaction Energy Based Prediction of Cytochrome P450 1A2 Binding Affinities with Reliability Estimation.
26530626 2015 The CYP1A2 -163C > A polymorphism is associated with super-refractory schizophrenia.
26514519 2015 Association between the CYP1A2 rs762551 Polymorphism and Bladder Cancer Susceptibility: a Meta-Analysis Based on Case-Control Studies.
26098700 2015 Polymorphisms of CYP1A2 and CYP2A6 activity: phenotypes and the effect of age and sex in a Nigerian population.
26068521 2016 Metabolism of the anthelmintic drug niclosamide by cytochrome P450 enzymes and UDP-glucuronosyltransferases: metabolite elucidation and main contributions from CYP1A2 and UGT1A1.
More...