Property Summary

NCBI Gene PubMed Count 415
PubMed Score 2022.49
PubTator Score 1808.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.197 2.4e-05
medulloblastoma, large-cell 1.200 1.9e-03
ovarian cancer -1.400 2.7e-07
psoriasis -4.700 5.5e-46

 GWAS Trait (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
410 confirmatory 4446 / 733 / 4019 p450-cyp1a2
1851 other 0 / 0 / 0 Cytochrome panel assay with activity outcomes
652076 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: LCMS-based biochemical cytochrome P450 inhibition assay
743029 other 1 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of vasopressin receptor 1a (V1a-R): LCMS-based biochemical cytochrome P450 inhibition assay

Gene RIF (427)

PMID Text
27093553 CYP1A2 metabolizes E2 to generate the potent anti-tumor agent 2-ME in HCC.
26865042 This large meta-analysis suggests no significant effect of the investigated CYP1A2 SNPs on cancer overall risk under various genetic models
26643992 Pregnane X receptor likely regulates CYP1A2 expression in 3D spheroids of liver cancer cells.
26588584 CYP rs2470890 allele 'C' showed an association with T2DM only when the interaction with coffee was considered, thereby setting an example of genetic activation by dietary changes associating with metabolic syndrome.
26582657 Dietary tocopherols inhibit PhIP-induced prostate carcinogenesis in CYP1A2-humanized transgenic mice.
26551865 For the computed CYP 1A2 binding affinities, the model showed a root mean square error of 4.1 kJ mol-1 and a standard error in prediction in cross-validation of 4.3 kJ mol-1.
26530626 The results of this study suggest that the CYP1A2*1F polymorphism is associated with super-refractory schizophrenia.
26514519 CYP1A2 rs762551 polymorphism is a protective factor for bladder cancer.
26098700 phenotypic association studies in population in Nigeria: Data suggest polymorphisms in CYP1A2 exist in the population studied; distribution of CYP1A2 activity is bimodal; influence of age/sex on activity are not significant in this biomarker study.
26068521 niclosamide was subjected to efficient metabolic reactions hydroxylation and glucuronidation, wherein CYP1A2 and UGT1A1 were the main contributing enzymes, respectively.
25921178 The CYP1A2 -3860A genotype was associated with a decreased risk of breast cancer. In contrast, distributions of the -2467T/delT or -2467delT/delT and -163A/C or A/A genotypes among breast cancer patients and controls were similar.
25826985 Age-dependent CYP1A2 gene polymorphism -163C>A in three ethnic groups of Bashkortostan Republic residents.
25795462 Data suggest that short-term fasting up-regulates hepatic expression of CYP1A2 but down-regulates hepatic expression of CYP2C9 as compared with the post-absorptive state; only male subjects were studied.
25602162 limb-truncal, but not orofacial tardive dyskinesia, is associated with CYP1A2 (-163C>, rs762551) polymorphism
25595320 coffee consumption increases the risk of impaired fasting glucose in hypertension particularly among carriers of the slow CYP1A2 *1F allele.
25552922 Allele frequency of CYP1A2 polymorphisms in the Japanese population
25472037 CYP1A2 polymorphisms are associated with lung cancer and bladder cancer risk in Caucasians. [Meta-analysis]
25461540 Results show high prevalence of functional CYP1A2*1F allele in Hungarian people suggesting an increased chance for breast, lung and ovarian cancer, mostly in case of susceptible exposure.
25326287 Treatment with plasma from ANC28.1-treated blood suppressed CYP1A2, CYP2B6, and CYP3A4 activity.
25306702 Molecular genetic markers of predisposition to the development of thyroid disease are: DD genotypes TD CYP1A2 gene (-2467delT), associated with the development of autoimmune thyroiditis.
25288136 Single-nucleotide polymorphisms alleles near BDNF that were associated with higher coffee consumption.
25264962 A graphene nanocage with regulatable space for the assembly of a CYP1A2-UGT1A10 bienzyme complex has been constructed via a click reaction, and used to study drug sequential metabolism using an electrochemically-driven method.
25240994 We suggest CYP2D6 4 genotype as a disease-susceptible genotype and low or high CYP1A2 activity levels as indicators of environmental influence in OLP subgroups.
25228302 WNT/beta-catenin pathway activation induces the expression of CYP2E1, CYP1A2, and aryl hydrocarbon receptor, but not of CYP3A4, hepatocyte nuclear factor-4alpha, or pregnane X receptor
25117321 The frequency of CYP1A2 1C mutation in Chinese patients with P. multiflorum-induced acute liver injury differed from that in healthy people, indicating that CYP1A2 1C is related to metabolism of P. multiflorum, which is followed by acute liver injury.
25115775 this meta-analysis indicates that CYP1A2*F, CYP1B1 Leu432Val, Asn453Ser, and Arg48Gly are not associated with colorectal cancer.
25081684 this meta-analysis indicates that the CYP1A2 rs762551 polymorphism is linked to an increased lung cancer risk in Caucasians
25059483 results indicate that expression of sleep onset delay relates to melatonin pathway genes.
25025048 Quercetin significantly inhibits the caffeine metabolism, which is unrelated to CYP1A2*1C (-2964G>A) and *1F (734C>A) gene polymorphisms.
24926919 Single nucleotide polymorphism (SNP)s in CYP1A2 and CYP1B1 show nominally significant associations with polychlorinated biphenyl (PCB)118 levels; genetic variation in CYP1A2 and CYP1B1 might also be associated with other PCBs.
24762860 Bleeding events of clopidogrel-treated patients after acute myocardial infarction were significantly more common among black carriers of CYP2C19*17 or CYP1A2*1C.
24668907 No statistically significant age-adjusted associations were observed between CYP1A2*1C, CYP1A2*1F, or NAT2*5 and gastroschisis
24583342 The effects of palmitine on aryl hydrocarbon receptor, CYP1A1 and CYP1A2 expression in hepatocytes and HepG2 cells are reported.
24555493 This study has identified an association between the CYP1A2 polymorphism -1545C > T (rs2470890) and the occurrence of more severe clozapine side effects.
24527758 believe that the findings are the first results of CYP allele distributions in the Turkish population and provide an understanding of the epidemiological studies that correlate therapeutic approaches and etiology of CRC especially in Turkish patients
24514875 CYP1A2-164 A/C polymorphism was not a risk factor for increasing colorectal cancer.
24488700 This study demonistrated that gene polymorphisms of CYP1A2 did not predict SSRI responses in Chinese Han depressed patients. Neuroendocrine factors also were not significant independent predictors for SSRI responses.
24443269 suggests no associations between CYP1A1 Ile462Val polymorphism and gastric cancer, but possible associations between CYP1A1 MspI and CYP1A2*1 F polymorphisms and gastric cancer
24443221 CYP3A5*3, CYP1A2*1F, CYP3A4*1B, and CYP2C19*2 were the most frequent alleles found in our sample. Significant differences in genotype and allelic distribution between African and European descents were observed for CYP3A4 and CYP3A5 genes
24340040 the number of drugs that are metabolized by each CYP, the impact of CYP SNPs, as well as CYP expression patterns in different tissues. The most important polymorphic CYPs were found to be 1A2, 2D6, 2C9 and 2C19.
24318358 High coffee and tea consuming subjects with slow CYP1A2 or NAT2 activity had a similar CRC risk compared to non/low coffee and tea consuming subjects with a fast CYP1A2 or NAT2 activi
24293373 These results from the meta-analysis suggest that CYP1A2 rs762551 polymorphism contributes to risk of lung cancer.
24099317 NAT2 acetylator genotype, the CYP1A2 polymorphism, and intakes of heterocyclic amines, meat-derived mutagenicity, and red meat were not associated with risk of postmenopausal breast cancer.
23951174 This meta-analysis suggests that the CYP1A2 *F and *C polymorphism is a protective factor against CRC among Asians.
23949201 Data indicate that genetic polymorphisms of aflatoxin B1 (AFB1) metabolic enzymes CYP2E1, EPHX1, GSTM1, and GSTT1 were not associated with gastric cancer, with the exception of CYP1A2.
23876819 Deoxyelephantopin produced no significant effect on CYP1A2 and CYP2D6 expression.
23859573 These results suggest that genetic variants in CYP1A2 may be indicators for S-CIT metabolism and that the fast metabolizers may experience more severe adverse reactions in the early stages of S-CIT treatment.
23803095 CYP1A2 -163C>A polymorphism is associated with lung cancer risk.
23628800 A allele of CYP1A2*1F polymorphism might be associated with breast and ovarian cancer risk, especially among Caucasian populations.[meta-analysis]
23603339 Dehydroepiandrosterone post-transcriptionally modifies CYP1A2 induction involving androgen receptor.
23601795 The resuts of this study found the *1F/*1F genotype to be significantly associated with seizures, and no relationship was observed with combinations of *1F and *1C alleles.
23492909 This is the first in-vivo demonstration of the influence of genes involved in CYP1A2 regulatory pathways on its basal activity and inducibility by smoking.
23492908 CYP1A1/CYP1A2 rs2472297C>T and AHR rs4410790C>T are potentially useful genetic markers associated with variability in CYP1A2-mediated metabolism, but are of minor quantitative importance for systemic OLA exposure.
23462460 rs3569413 polymorphism of the CYP1A2 gene is associated with an increased risk of lung cancer.
23353840 Human cytochrome P450 (CYP) 1A1 and 1A2 enzymes were found to be responsible for the aristolochic acid I reductive activation to form AAI-DNA adducts, while its structurally related analogue, CYP1B1 is almost without such activity.
23292087 The amino Acid Substitution in CYP1A2 is associated with CYP1A2 inducibility, drug metabolism, coffee consumption, and blood pressure
23278694 A higher CYP1A2 activity (mean +/- standard deviation) was found in the morning.
23167834 CYP1A2 gene polymorphisms appeared to have limited influence on theophylline metabolism in this study.
23157985 A significant association between CYP1A2 rs762551C variant with risk of cancer.
23138776 Several CYP1A2 haplotypes containing the -2467delT variant were associated with lower lung cancer risk, however, they did not correlate with significant changes in CYP1A2 metabolic activity toward caffeine.
23133610 3-Pyridyl substituted aliphatic cycles as CYP11B2 inhibitors: aromaticity abolishment of the core significantly increased selectivity over CYP1A2
23128882 the -3860A variant, by decreasing CYP1A2 activity, modifies BC risk by interacting with environmental factors, thereby supporting the hypothesis that reduced CYP1A2 activity contributes to BC risk in different ways.
23081704 This study reveals no association between the metabolic profiles of CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes and both current suicide risk and personal history of suicide attempts.
22949628 Both compounds displayed similar binding orientations within the active site of CYP1A1 and CYP1A2.
22948892 In this study of individuals of South Asian and European ancestry, variability in CYP1A2 activity can be explained by diet, lifestyle and genetic factors.
22855999 Association of polymorph variants of CYP1A1 and CYP1A2 genes with reproductive and thyroid diseases risk in female workers of petrochemical industry.
22854411 genetic association studies in a Costa Rican population: Previous associations observed between an SNP in CYP1A2 (rs2470893) and caffeine/coffee consumption in European populations are also observed in an ethnically distinct Costa Rican population.
22823064 Of 15 patients with disappearing effectiveness of melatonin, seven were diagnosed with autism spectrum disorder, and in four of them a SNP was found.
22785257 CYP1A2 enzyme activity was much more markedly increased in Sprague-Dawley than Wistar rats and CYP1A1 activity was induced to similar levels.
22749033 results demonstrate that CYP1A2 variant C of -163A/C, even independent of smoking exposure, may increase lung cancer risk, whereas variant delT of -2467 T/delT interacts with cigarette smoking to modify lung cancer risk in males
22673010 CYP1A2 activity was higher in both genders after drug administration.
22648710 genetic association studies in a population in the Netherlands: Data suggest that CYP1A2 genotype, sex, age, and smoking influence coffee intake.
22628494 The combined effects on the risk of adenoma of heterocyclic amines intakes and NAT2 activity (but not CYP1A2 activity) were statistically significant.
22492992 In non-smokers, the CYP1A2 variants were associated with higher caffeine intake.
22466345 African-American single-variant CYP 1A2 carriers who smoked were more likely to report hot flashes than the nonsmoking carriers.
22448362 impact of both studied polymorphisms was essential for urinary levels of 3-hydroxymethylantipyrine (metabolite most dependent on cytochrome P-4501A2) and hence, for functional activity of this isoform of the enzyme
22426036 Genetic polymorphisms, allele frequencies of the CYP1A2 enzyme were determined in a Jordanian population and compared with other ethnic groups
22336631 Caffeine intake increases tear volume and polymorphisms within ADORA2A, and CYP1A2 is associated with the tear increase after caffeine intake.
22258279 Estimated hepatic CYP1A2 abundance values were 52, 64, 79, 90, and 94 pmol/mg microsomal protein for subjects smoking 0, 1-5, 6-10, 11-20, and >20 cigarettes/day respectively.
22246422 Cytochrome P450 oxidoreductase genetic polymorphisms influence CYP1A2 basal but not induced activity and do not seem to influence CYP1A2 inducibility(CYP1A2 )
22228482 Scutellarin might have a weak inhibitory effect on the activity of CYP1A2 in rats.
22141270 The incidence of the 2 CYP1A2 SNPs showed no significant difference between the benign prostatic hyperplasia and the castrated prostate cancer patients.
22086975 Report bioactivation versus detoxication of the urothelial carcinogen aristolochic acid I by human cytochrome P450 1A1 and 1A2.
22072123 CYP1A2 genotypes interact with environmental risk factors in enhancing the risk to squamous cell lung carcinoma.
21977969 Women in Siberia with SNPS in CYP1A1 gene, in CYP1A2 gene,and in the SULT1A1 gene have an increased risk of development of breast cancer .
21929532 The CYP1A2 genotype does not appear to be a major susceptibility factor in the development of familial and sporadic porphyria cutanea tarda in the French population.
21876539 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM
21825116 Methanol is the suitable solvent and has no significant effects on CYP1A2-mediated phenacetin O-deethylation.
21598960 effects of a peripheral mutation on the enzymatic activity
21505853 Molecular mechanisms of cold-induced CYP1A activation in rat liver microsomes
21490707 Both the AHR and CYP1A2 genes are biologically plausible candidates as CYP1A2 metabolizes caffeine and AHR regulates CYP1A2.
21480221 The findings of our study demonstrate that CYP1A2 phenotype may be an important contributing factor in the development of smoking-related bladder cancer in humans.
21357676 CYP1A2 is the main caffeine metabolizing enzyme.
21329464 The results of the study suggest that NQO1 exon 6 proline187serine (C609T) and CYP1A2 exon 2 phenylalanine21leucine (C63G) polymorphisms do not play a significant role in breast cancer susceptibility in North Indian women.
21281405 Coffee-Parkinson's disease association is strongest among slow metabolizers of caffeine who are homozygous carriers of CYP1A2 polymorphisms.
21262253 In a hepatoma cell line cytochrome P450, CYP1A2 (and CYP1A1) were induced following tanshinones administration.
21210738 CYP1A2 was the specific isozyme responsible for the C5-hydroxylation metabolism of liquiritigenin in human liver microsomes.
21148426 Enhanced clopidogrel response in smokers, known as the smokers' paradox, is not universal but was observed only in cytochrome P450 CYP1A2 (-163C>A) A-allele carriers, suggesting a genotype-dependent effect of smoking on clopidogrel responsiveness.
21086794 Observational study of gene-disease association. (HuGE Navigator)
21081473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21072184 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21071160 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20957336 Data indicate that CYP1A2*1F promoter A allele and A/A genotype and the wild-type GSTM1 allele are risk factors for the development of porphyria cutanea tarda.
20957336 Observational study of gene-disease association. (HuGE Navigator)
20933493 ionic strength, as varied by the buffer concentration, and temperature alter the rate without affecting substrate binding while buffer type and pH alter both
20930417 polymorphisms, -2467delT and -163C>A were detected at high frequencies in Chinese, Malay and Indian ethnic groups in Singapore.
20930417 Observational study of genotype prevalence. (HuGE Navigator)
20881513 CYP1A2 is more variable than previously thought: a genomic biography of the gene behind the human drug-metabolizing enzyme
20853468 Caffeine has been extensively used as a probe to measure CYP1A2 activity in humans. The assay developed is a robust, simple and precise technique to measure caffeine and paraxanthine in saliva and plasma.
20829355 Data show that AIP is not required for the induction of the Cyp1a1 and Cyp1a2 genes.
20806393 Differential mechanisms for the inhibition of human cytochrome P450 1A2 by apigenin and genistein.
20797314 The genotype frequencies of the CYP1A2*1D and CYP1A2*1F were found to be significantly different in the patients compared to the controls.
20797314 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20691427 Observational study of gene-disease association. (HuGE Navigator)
20663043 These studies demonstrated that Danshen aqueous extract affected the metabolism of CYP1A2 substrates through competitive inhibition and altered their clearance.
20656072 Data show that CYP2A6 and CYP1A2 have the least malleable active sites while those of CYP2D6, CYP2C9 and CYP3A4 have considerably greater degrees of flexibility or malleability.
20652353 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20641098 Mothers who consumed caffeine, oxidized CYP1A2*1F quickly, and acetylized NAT2 slowly had a nonsignificantly elevated estimated risk for an neural tube defects-affected pregnancy.
20641098 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20602612 Observational study of gene-disease association. (HuGE Navigator)
20583967 Report the concentration-dependent response and time-course for the induction of CYP1A2 by inducing agents beta-naphthoflavone, phenobarbital and rifampicin, respectively in two or more donors using multiple end-points.
20559687 CYP1A2 (cytochrome P450 family 1 subfamily A polypeptide 2) -2467T/delT modifies the effect of cigarette smoking on Bladder Cancer risk.
20559687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20505544 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20390257 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20389299 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20304699 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20218903 Single nucleotide polymorphisms induces the CYP1A2 gene, thereby increasing metabolic reactions.
20218903 Observational study of genotype prevalence. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20213484 Observational study of gene-disease association. (HuGE Navigator)
20175915 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20163457 Smoking but not homozygosity for CYP1A2 g-163A allelic variant leads to earlier disease onset in patients with sporadic porphyria cutanea tarda.
20163457 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20147896 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20131310 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20125119 variant G299S is substantially altered in catalytic properties in comparison with WT, whereas variant T83M is slightly but significantly different from the WT.
20118554 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20080081 The CYP1A2 haplotype, 462Val:3860G and 462Val:3801T:3860G were significantly over-represented (p=0.001 and p=0.003), respectively in patients.
20080081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20054636 Meta-analysis: Not enough evidence to indicate an association of CYP1A2-164 A/C polymorphism and breast cancer development.
20054636 Observational study of gene-disease association. (HuGE Navigator)
20047124 there was no evidence of any influence by genetic polymorphisms of NAT2, CYP1A1, and CYP1A2 on the risk of stomach cancer
20047124 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20043572 The researchers found no evidence of an association between CYP1A2 activity and the status of disease in beta thalassemia patients despite the presence of an oxidative stress state.
20029944 Observational study of gene-disease association. (HuGE Navigator)
19961320 more than 15 variant alleles and a series of subvariants of the CYP1A2 gene have been identified and some of them have been associated with altered drug clearance and response and disease susceptibility (Review)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19926050 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19860743 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19843669 There was no overall effect of CYP1A2*1F or GSTM1-null/GSTT1-null genotypes or genotype-by-diet interactions, there were significant diet response differences within each genotype.
19843669 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19823875 Studies indicate that of the 200 most clinically used drugs, 73% require metabolism and 72% of the enzymes responsible are members of the P450 superfamily, predominantly CYP3A4, CYP2D6, CYP2C19, CYP2C9, and CYP1A2.
19822571 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19806921 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19776291 Observational study of gene-disease association. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19682433 ER8 motif is highly conserved in the CYP1A1 proximal promoter sequences of various species, suggesting a fundamental role of CAR in the xenobiotic-induced expression of CYP1A1 and CYP1A2 independent of aryl hydrocarbon receptor
19666078 Suggest that CYP1 family enzymes enhance the antiproliferative activity of dietary flavonoids in breast cancer cells, through bioconversion to more active products.
19643819 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19636338 Observational study of gene-disease association. (HuGE Navigator)
19605743 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593168 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593158 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19583676 determined the frequencies of CYP1A2 gene polymorphisms, analyze Linkage disequilibrium (LD) blocks and haplotypes in a Korean population, and compared them with those in African, European, Japanese and Chinese populations
19583676 Observational study of genotype prevalence. (HuGE Navigator)
19576320 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19571439 our results show that the GC box is a critical element for the CYP1A2 promoter and its epigenetic regulation mediated by CpG methylation may play important roles in the tissue-specific CYP1A2 gene expression
19569730 The study with a chemical selective inhibitor, cDNA-expressed human CYPs, a correlation assay, and a kinetics study demonstrated that CYP1A2 was the major isoform responsible for the paeonol O-demethylation in human liver microsomes.
19534587 TS has significantly induced the activity of CYP1A2 in vivo. Simultaneously, AUC((0-24h)) of caffeine and paraxanthine were significantly affected by STS.
19507017 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19479063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19452301 no association was found between HCA intake and colorectal cancer, or any evidence of influence by genetic polymorphisms of NAT2, CYP1A1, and CYP1A2.
19451835 risk of hypertension associated with coffee intake varies according to CYP1A2 genotype.
19450128 The influence of the -163C>A single nucleotide polymorphism on CYP1A2 activity in smokers suggests an effect on the inducibility of the enzyme.
19442564 The CYP1A2*1C polymorphism was associated with head and neck squamous cell recurrence (log-rank test, P=0.0161).
19430483 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19415745 Single nucleotide polymorphisms in the CYP1A2 is Associated with premenopausal breast cancer women.
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414633 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19356113 The metabolism and biotransformation of the (14)C-labeled phenylurea herbicide fluometuron was examined using tobacco cell suspension cultures transformed separately with human cyp1a2
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19338043 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19332078 This study suggests that single nucleotide polymorphisms of CYP1A2 could be considered as promising biomarkers in the aetiology of lung adenocarcinoma in smokers
19332078 Observational study of gene-disease association. (HuGE Navigator)
19307236 Observational study of gene-disease association. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19285097 mouse liver CYP1A1-specific enzyme activities are between 38- and 170-fold higher than human CYP1A1-specific enzyme activities (per unit of mRNA), whereas mouse versus human CYP1A2 enzyme activities (per unit of mRNA) are within 2.5-fold of one another.
19276377 Authors use custom genotyping panel containing 50 single nucleotide polymorphisms in the CYP1A1/2 region and 184 ancestry informative markers selected to have large allele frequency differences between Africans, Europeans, and Amerindians.
19276377 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19274061 CYP1A2 gene expression is influenced by the extent of DNA methylation and displays allele-specific expression, mechanisms contributing to the large interindividual differences in CYP1A2 gene expression
19273964 association between colorectal cancer and cytochrome P-450 1A2, N-acetyltransferase 1, and N-acetyltransferase 2, with the interaction of meat consumption.
19273964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19229255 Observational study of gene-disease association. (HuGE Navigator)
19106084 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19095219 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19026171 Results describe the inhibitory potential of 2 new fluoroquinolones, caderofloxacin and antofloxacin, together with 4 marketed fluoroquinolones, on the activity of cytochrome P450 isoforms 1A2 (CYP1A2) and 2C9 (CYP2C9).
19000940 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18941913 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18850169 Observational study of gene-disease association. (HuGE Navigator)
18840375 The goal of this study was to assess the activities of cytochrome P450 (CYP) 1A2, N-acetyltransferase 2, xanthine oxidase, and CYP2D6 in children with isolated idiopathic
18825963 The frequencies of each polymorphism in Turkish population were found as 0.04, 0.92, 0.01, 0.27 for CYP1A2*1C, CYP1A2*1D, CYP1A2*1E, CYP1A2*1F, respectively
18825963 Observational study of genotype prevalence. (HuGE Navigator)
18813311 the CYP1A2*1F genotype significantly modified the relationship between coffee consumption and breast volume in non-users of hormonal contraception.
18813311 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18801337 These results suggest that the functional roles of CYP1A2 and 2E1 can be switched by interaction with a specific anionic lysophospholipid in vivo.
18798002 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18784359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18759349 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18751408 Findings may indicate that the association between cigarette smoking and colorectal carcinogenesis can be modified by the CYP1A2 genotype.
18751408 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18703023 The results indicate that phenotypic differences in NAT2 alone or in combination with CYP1A2 might help explain the higher incidence rates of transitional cell bladder cancer in white cigarette smokers compared with black smokers.
18690546 no association with bladder cancer found
18690546 Observational study of gene-disease association. (HuGE Navigator)
18632753 Observational study of gene-disease association. (HuGE Navigator)
18628519 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18619574 caffeine 1-N-demethylation is specifically catalyzed by CYP1A2; caffeine C-8-hydroxylation preferentially involves CYP1A2 and CYP3A4; 7-N-demethylation is catalyzed non-specifically, mainly by CYP1A2
18569587 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18551037 The activity of individual P450 oxidoreductase mutants may vary greatly depending on the electron recipient used to assay activity.
18544563 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18499698 The CYP1A2 genotype showed significant interaction with heavy smoking in women not men
18499698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18497059 CYP1A2 polymorphism is associated with breast and ovarian cancer
18497059 Observational study of gene-disease association. (HuGE Navigator)
18496682 Genetic polymorphisms of CYP1A2 in rheumatoid arthritis patients are reported.
18496682 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18493746 Pharmacologic profiling of CYP1A2 induction and competition is reported.
18490497 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18466106 The functional significance and clinical importance of CYP1A2 gene polymorphisms are reviewed and interethnic differences in the distribution of CYP1A2 variant alleles and haplotypes are summarized.
18455494 Impairment of CYP1A2-mediated xenobiotic metabolism by Antley-Bixler syndrome variants of cytochrome P-450 oxidoreductase is reported.
18398030 coffee slows the growth of ER-positive tumors in patients with CYP1A2*1F A/A and may have implications for breast cancer if confirmed.
18398030 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18389617 Association of cytochrome P450 genes polymorphisms (CYP1A1 and CYP1A2) with the development of chronic obstructive pulmonary disease in Bashkortostan
18389617 Observational study of gene-disease association. (HuGE Navigator)
18318428 Observational study of gene-disease association. (HuGE Navigator)
18268115 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18231117 Observational study of gene-disease association. (HuGE Navigator)
18223460 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18200441 We observed non-significant association in T/C polymorphism of the CYP1A1 gene and tobacco use and bladder cancer
18187423 analysis of ligand binding in cytochrome P450 1A2
18180754 Meta-analysis of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18159984 The combination of NAT2 plus CYP1A2*1C, and that of CYP1A2*1F plus CYP1A2*1C, may strongly confer genetic susceptibility to colorectal cancer in Japanese never-smokers.
18159984 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18077912 Observational study of gene-disease association. (HuGE Navigator)
18075470 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18052847 Here are presented several in vitro methods to detect induction of CYP1A2 and CYP3A4 in fresh and cryopreserved primary human hepatocytes
17900275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17852022 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17852022 Genetic variations in CYP1A1 and CYP1A2 genes do not seem to influence riluzole levels.
17823234 Discuss approaches to investigate mechanism of CYP1A2 inhibition.
17823232 Used shuffled CYP1A2library to examine genotype/phenotype of mutant forms.
17695473 Observational study of gene-disease association. (HuGE Navigator)
17688403 Observational study of gene-disease association. (HuGE Navigator)
17688403 No association between the CYP1A2 polymorphism and tardive dyskinesia was found in a Turkish population.
17635176 Observational study of genotype prevalence. (HuGE Navigator)
17627011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17616786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17615053 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17615053 This study provides some support for polymorphic variation in CYP1A2 and CYP1B1 playing a role in colorectal cancer susceptibility.
17611010 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17611010 The results of this study suggest that the CYP1A2(*)1F polymorphism may contribute to the risk of developing prolonged QT-interval in patients who are treated with higher doses of antipsychotics.
17603900 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17603224 Observational study of genotype prevalence. (HuGE Navigator)
17564586 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17509724 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17509724 CYP1A2-T2467delT polymorphism has an important role in lung carcinogenesis, especially SCC, among smokers.
17507624 Observational study of gene-disease association. (HuGE Navigator)
17507615 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17507615 study examined whether the CYP1A2 genotype modifies the association between a history of coffee consumption and the risk of breast cancer among BRCA1 mutation carriers
17503978 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17503978 CYP1A2 variants *1C and *1D seem to be associated with higher serum clozapine concentrations and an increased risk of developing insulin and lipid elevations and insulin resistance on a given dose of clozapine
17498780 Observational study of gene-disease association. (HuGE Navigator)
17477782 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17477782 CYP1A2 polymorphisms are associated with lung cancer
17429315 Observational study of gene-disease association. (HuGE Navigator)
17418993 An inhibition assay was developed and validated for CYP1A2 in liver microsomes.
17372239 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17370067 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17370067 We found significant differences in CYP1A2 enzyme activity between Swedes and Koreans. None of the investigated CYP1A2 haplotypes are critical in inducing variations in enzyme activity, with the exception of CYP1A2*1F.
17363580 Observational study of gene-disease association. (HuGE Navigator)
17345072 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17295924 Observational study of gene-disease association. (HuGE Navigator)
17259654 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17191090 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17178267 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17164366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17065585 Formula feeding appears to accelerate maturation of caffeine and DM metabolism by increasing the activity of CYP1A2 and CYP3A4, respectively.
16985250 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985026 Observational study of gene-disease association. (HuGE Navigator)
16969362 Unlikely that CYP1A2 1545 C>T polymorphism contributes to the pathogenesis of tardive dyskinesia and schizophrenia.
16933202 Observational study of genotype prevalence. (HuGE Navigator)
16933202 This study is the first to investigate the distribution of the CYP1A2 (-163 C > A single nucleotide polymorphism) mutant allele in Ovambo, Korean and Mongolian populations.
16882880 These results establish the importance of coactivators PGC1alpha and SRC1 for the hepatic expression of human P450s and uncover a new HNF4alpha-dependent regulatory mechanism to constitutively control the CYP1A1/2 cluster.
16864595 Observational study of gene-disease association. (HuGE Navigator)
16800822 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16800822 The genotypes and allele frequencies of the MDR1/C3435T, FMO3/G488A, FMO3/A923G and CYP1A2/G-3860 A polymorphisms were not significantly different in cancer-free subjects and CRC patients.
16782969 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16775389 Observational study of gene-disease association. (HuGE Navigator)
16772608 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16740387 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16636061 maternal hepatic CYP1A2, by sequestering dioxin and thus altering the pharmacokinetics, protects the embryos from toxicity and birth defects
16609368 Observational study of gene-disease association. (HuGE Navigator)
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16538170 Observational study of gene-disease association. (HuGE Navigator)
16538170 CYP1A2 polymorphisms may not be related to breast cancer risk.
16505155 Induction of human CYP1A1 and CYP1A2 is simultaneously controlled through bidirectional and common regulatory elements.
16495781 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16495781 CYP1A2 genetic polymorphisms are associated with HCC susceptibility in smokers and HBsAg seronegative individuals in the Fusui endemic region of China
16471212 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16426572 CYP1A1 and CYP1A2 induction by TCDD is differentially regulated in primary human hepatocytes versus transformed human cells
16406813 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16402549 Transgenic enzyme metabolizes 4-n-nonylphenol in tobacco cultures.
16402077 Observational study of gene-disease association. (HuGE Navigator)
16385402 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16324277 Isoniazid and rifampicin in the range of maximum clinical blood concentration have no significant inducing or inhibiting effect on the activity of CYP1A2 of healthy adult human primary hepatocytes.
16307269 Observational study of genetic testing. (HuGE Navigator)
16204462 A new human hepatoma cell line (HepaRG) is found to able to express the major P450-related activities.
16188490 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16172230 Observational study of gene-disease association. (HuGE Navigator)
16157215 Observational study of gene-disease association. (HuGE Navigator)
16153396 Observational study of gene-disease association. (HuGE Navigator)
16130011 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16103451 Observational study of gene-disease association. (HuGE Navigator)
16048566 Observational study of gene-disease association. (HuGE Navigator)
16006997 Observational study of gene-disease association. (HuGE Navigator)
15996939 CYP1A1*2a may have a role in progression of acute myeloid leukemia
15987714 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15987714 Polymorphisms of the CYP1A2 and NAT1 genes is associated with pancreatic cancer risk
15949157 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15941966 Observational study of gene-disease association. (HuGE Navigator)
15901993 Observational study of gene-disease association. (HuGE Navigator)
15890241 Observational study of gene-disease association. (HuGE Navigator)
15849225 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15849225 An increase in caffeine intake deteriorates the fecundity among women who have homozygous CYP1A21F alleles
15774926 Observational study of gene-disease association. (HuGE Navigator)
15770072 Observational study of genotype prevalence. (HuGE Navigator)
15770072 polymorphisms and haplotype frequencies of CYP1A2 in a Japanese population
15763632 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15734958 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15643613 Determination of SNP frequencies in the CYP1A1_CYP1A2 locus.
15564895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15564895 No associations with polymorphisms of CYP1A2 gene and Tardive dyskinesia in Japanese patients with schizophrenia.
15519301 kinetic analysis of cytochrome P450 1A2
15505641 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15466009 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15466009 The low inducibility genotype for CYP1A2 was associated with an increased risk of myocardial infarction
15387446 Observational study of genotype prevalence. (HuGE Navigator)
15382051 Observational study of gene-disease association. (HuGE Navigator)
15363478 CYP1A2 gene is implicated in paranoid schizophrenia
15349722 marked impairment of CYP enzyme activity during allograft rejection which is presumably secondary to an increased intragraft production of proinflammatory cytokines and NO.
15299091 Observational study of gene-disease association. (HuGE Navigator)
15241822 CYP1A1-1 (P = 0.004) and CYP1A1-2 (P = 0.03) were found to be associated with significantly decreased and increased risks of breast carcinoma, respectively.
15110095 Observational study of gene-disease association. (HuGE Navigator)
14976127 decrease in activity is associated with testicular cancer
14723376 Mutations in the Plasmodium falciparum cytochrome B1 gene have been implied in resistance to atovaquone/proguanil combination.
14714565 Observational study of gene-disease association. (HuGE Navigator)
14695651 Observational study of genotype prevalence. (HuGE Navigator)
14648207 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14640293 Observational study of gene-disease association. (HuGE Navigator)
12943470 Observational study of genetic testing. (HuGE Navigator)
12925300 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12920202 Observational study of genotype prevalence. (HuGE Navigator)
12920202 A novel polymorphism in intron 1 of CYP1A2 affecting expression and inducibility of the enzyme, was sequenced in Ethiopians.
12900870 Incubation of racemic and nonracemic methadone with CYP3A4 revealed no stereoselectivity for the transformation to EDDP, whereas no EDDP formation was observed with CYP1A2.
12851801 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
12790158 Observational study of gene-environment interaction. (HuGE Navigator)
12732846 Observational study of gene-disease association. (HuGE Navigator)
12692107 Observational study of gene-disease association. (HuGE Navigator)
12692107 High-activity CYP1A2 and CYP1B1 alleles, whose gene products metabolize estradiol, were not associated with pubertal stage.
12663508 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12630986 Observational study of genotype prevalence. (HuGE Navigator)
12618594 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12569554 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12566081 CYP1A2 can support uroporphyrin accumulation in hepatoma cells and thus may play a role in human porphyria cutanea tarda .
12534642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12484238 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12445035 Observational study of gene-environment interaction. (HuGE Navigator)
12445029 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12181774 DNA sequence variation in a 3.7-kb noncoding sequence 5' of the CYP1A2 gene: implications for human population history and natural selection.
12147246 characterization of human CYP1A1/1A2 induction by DNA microarray and alpha-naphthoflavone
12067576 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11943609 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11817502 Observational study of gene-environment interaction. (HuGE Navigator)
11791895 CYP1A2 catalyzes other less important pathways, such as degradation at the amino/ethanolamino group.
11782366 Comparative aflatoxin B(1) activation and cytotoxicity in human bronchial cells expressing cytochromes P450 1A2 and 3A4.
11763009 Observational study of gene-disease association. (HuGE Navigator)
11749050 Observational study of gene-disease association. (HuGE Navigator)
11749050 Investigators examining possible associations between early menarche and mutations in genes of estrogen metabolism found no such association for this gene.
11507974 Observational study of genotype prevalence. (HuGE Navigator)
11501059 Observational study of genotype prevalence. (HuGE Navigator)
11496364 Observational study of gene-disease association. (HuGE Navigator)
11470995 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11393588 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11275366 Observational study of gene-disease association. (HuGE Navigator)
11186132 Observational study of genotype prevalence. (HuGE Navigator)
11153915 Observational study of gene-disease association. (HuGE Navigator)
10791558 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and healthcare-related. (HuGE Navigator)

AA Sequence

MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQ      1 - 70
RYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLA     71 - 140
QNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFP    141 - 210
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSV    211 - 280
RDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTV    281 - 350
IGRERRPRLSDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL    351 - 420
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGVKVD    421 - 490
LTPIYGLTMKHARCEHVQARRFSIN                                                 491 - 515
//

Text Mined References (419)

PMID Year Title
27093553 2016 Cytochrome P450 1A2 Metabolizes 17?-Estradiol to Suppress Hepatocellular Carcinoma.
26865042 2016 Lack of association between polymorphisms in the CYP1A2 gene and risk of cancer: evidence from meta-analyses.
26643992 2015 CYP1A1 and CYP1A2 expression levels are differentially regulated in three-dimensional spheroids of liver cancer cells compared to two-dimensional monolayer cultures.
26588584 2016 Caffeine Impact on Metabolic Syndrome Components Is Modulated by a CYP1A2 Variant.
26582657 2016 Dietary tocopherols inhibit PhIP-induced prostate carcinogenesis in CYP1A-humanized mice.
26551865 2015 Linear Interaction Energy Based Prediction of Cytochrome P450 1A2 Binding Affinities with Reliability Estimation.
26530626 2015 The CYP1A2 -163C > A polymorphism is associated with super-refractory schizophrenia.
26514519 2015 Association between the CYP1A2 rs762551 Polymorphism and Bladder Cancer Susceptibility: a Meta-Analysis Based on Case-Control Studies.
26098700 2015 Polymorphisms of CYP1A2 and CYP2A6 activity: phenotypes and the effect of age and sex in a Nigerian population.
26068521 2016 Metabolism of the anthelmintic drug niclosamide by cytochrome P450 enzymes and UDP-glucuronosyltransferases: metabolite elucidation and main contributions from CYP1A2 and UGT1A1.
25921178 2015 Breast Cancer Association with CYP1A2 Activity and Gene Polymorphisms--a Preliminary Case-control Study in Tunisia.
25826985 2014 [Age-dependent CYP1A2 gene polymorphism -163C>A in three ethnic groups of Bashkortostan Republic residents].
25795462 2015 Short-term fasting alters cytochrome P450-mediated drug metabolism in humans.
25602162 2015 Cytochrome P450 1A2 co-determines neuroleptic load and may diminish tardive dyskinesia by increased inducibility.
25595320 2015 Association of coffee consumption and CYP1A2 polymorphism with risk of impaired fasting glucose in hypertensive patients.
25552922 2015 Combination analysis in genetic polymorphisms of drug-metabolizing enzymes CYP1A2, CYP2C9, CYP2C19, CYP2D6 and CYP3A5 in the Japanese population.
25472037 2015 Association between the CYP1A2 polymorphisms and risk of cancer: a meta-analysis.
25461540 2014 Genetic polymorphisms in promoter and intronic regions of CYP1A2 gene in Roma and Hungarian population samples.
25326287 2015 Anti-CD28 monoclonal antibody-stimulated cytokines released from blood suppress CYP1A2, CYP2B6, and CYP3A4 in human hepatocytes in vitro.
25306702 [DIO2, TPO, CYP1A1 AND CYP1A2 gene polymorphism in women with thyroid disease].
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
25281661 2015 Genome-wide association study identified SNP on 15q24 associated with bladder cancer risk in Japanese population.
25264962 2014 Electrochemically driven drug metabolism via a CYP1A2-UGT1A10 bienzyme confined in a graphene nano-cage.
25240994 2014 Subgrouping of patients with oral lichen planus according to cytochrome P450 enzyme phenotype and genotype.
25228302 2014 The WNT/?-catenin pathway is a transcriptional regulator of CYP2E1, CYP1A2, and aryl hydrocarbon receptor gene expression in primary human hepatocytes.
25117321 2014 CYP1A2 polymorphism in Chinese patients with acute liver injury induced by Polygonum multiflorum.
25115775 2014 Association between CYP1A2 and CYP1B1 polymorphisms and colorectal cancer risk: a meta-analysis.
25081684 2014 Four polymorphisms in the cytochrome P450 1A2 (CYP1A2) gene and lung cancer risk: a meta-analysis.
25059483 2015 Genetic variation in melatonin pathway enzymes in children with autism spectrum disorder and comorbid sleep onset delay.
25025048 2014 Quercetin significantly inhibits the metabolism of caffeine, a substrate of cytochrome P450 1A2 unrelated to CYP1A2*1C??(-2964G>A) and *1F (734C>A) gene polymorphisms.
24926919 2014 Genetic variation in the CYP1A1 gene is related to circulating PCB118 levels in a population-based sample.
24762860 2014 Cytochrome p450 gene variants, race, and mortality among clopidogrel-treated patients after acute myocardial infarction.
24668907 2014 Maternal smoking, xenobiotic metabolizing enzyme gene variants, and gastroschisis risk.
24583342 2014 Palmatine activates AhR and upregulates CYP1A activity in HepG2 cells but not in human hepatocytes.
24555493 2014 CYP1A2 polymorphism -1545C > T (rs2470890) is associated with increased side effects to clozapine.
24527758 2014 Genetic variations in the xenobiotic-metabolizing enzymes CYP1A1, CYP1A2, CYP2C9, CYP2C19 and susceptibility to colorectal cancer among Turkish people.
24514875 2014 Association between the CYP1A2-164 A/C polymorphism and colorectal cancer susceptibility: a meta-analysis.
24488700 2014 Neither cytochrome P450 family genes nor neuroendocrine factors could independently predict the SSRIs treatment in the Chinese Han population.
24443269 2014 The effect of CYP1A1 and CYP1A2 polymorphisms on gastric cancer risk among different ethnicities: a systematic review and meta-analysis.
24443221 2014 Characterization of CYP1A2, CYP2C19, CYP3A4 and CYP3A5 polymorphisms in South Brazilians.
24340040 2013 Polymorphic cytochrome P450 enzymes (CYPs) and their role in personalized therapy.
24318358 2014 Coffee and tea consumption, genotype-based CYP1A2 and NAT2 activity and colorectal cancer risk-results from the EPIC cohort study.
24293373 2014 CYP1A2 rs762551 polymorphism contributes to risk of lung cancer: a meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24099317 2013 Polymorphisms in xenobiotic metabolizing genes, intakes of heterocyclic amines and red meat, and postmenopausal breast cancer.
23951174 2013 quantitative assessment of the influence of cytochrome P450 1A2 gene polymorphism and colorectal cancer risk.
23949201 2013 Dietary aflatoxin B1 intake, genetic polymorphisms of CYP1A2, CYP2E1, EPHX1, GSTM1, and GSTT1, and gastric cancer risk in Korean.
23876819 2013 Evaluation of in vitro cytochrome P450 induction and inhibition activity of deoxyelephantopin, a sesquiterpene lactone from Elephantopus scaber L.
23859573 2013 CYP1A2 genetic polymorphisms are associated with early antidepressant escitalopram metabolism and adverse reactions.
23803095 2013 Meta-analysis of the CYP1A2 -163C>A polymorphism and lung cancer risk.
23628800 2013 Role of CYP1A2 1F polymorphism in cancer risk: evidence from a meta-analysis of 46 case-control studies.
23603339 2013 Dehydroepiandrosterone post-transcriptionally modifies CYP1A2 induction involving androgen receptor.
23601795 2013 The CYP1A2 -163C>A polymorphism is associated with clozapine-induced generalized tonic-clonic seizures in Brazilian schizophrenia patients.
23492909 2013 Pharmacogenetics of CYP1A2 activity and inducibility in smokers and exsmokers.
23492908 2013 Influence of CYP1A1/CYP1A2 and AHR polymorphisms on systemic olanzapine exposure.
23462460 2013 Current evidence on the relationship between three polymorphisms in the CYP1A2 gene and the risk of cancer.
23353840 2012 Theoretical investigation of differences in nitroreduction of aristolochic acid I by cytochromes P450 1A1, 1A2 and 1B1.
23292087 2013 CYP1A2*1E [corrected] contains the -163C>A substitution and is highly inducible.
23278694 2013 Diurnal variation in CYP1A2 enzyme activity in South Asians and Europeans.
23167834 2013 Association between common CYP1A2 polymorphisms and theophylline metabolism in non-smoking healthy volunteers.
23157985 2012 CYP1A2 rs762551 polymorphism contributes to cancer susceptibility: a meta-analysis from 19 case-control studies.
23138776 2013 Haplotypes in the 5'-untranslated region of the CYP1A2 gene are inversely associated with lung cancer risk but do not correlate with caffeine metabolism.
23133610 2012 3-Pyridyl substituted aliphatic cycles as CYP11B2 inhibitors: aromaticity abolishment of the core significantly increased selectivity over CYP1A2.
23128882 2013 Role of CYP1A2 polymorphisms in breast cancer risk in women.
23081704 2013 The impact of Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes on suicide attempt and suicide risk-a European multicentre study on treatment-resistant major depressive disorder.
22949628 2012 Preferred binding orientations of phenacetin in CYP1A1 and CYP1A2 are associated with isoform-selective metabolism.
22948892 2012 Influence of environmental and genetic factors on CYP1A2 activity in individuals of South Asian and European ancestry.
22855999 2012 [Association of polymorph variants of CYP1A2 and CYP1A1 genes with reproductive and thyroid diseases in female workers of petrochemical industry].
22854411 2012 Associations between polymorphisms in the AHR and CYP1A1-CYP1A2 gene regions and habitual caffeine consumption.
22823064 2013 CYP1A2 polymorphisms in slow melatonin metabolisers: a possible relationship with autism spectrum disorder?
22785257 2012 Differential inducing effect of benzo[a]pyrene on gene expression and enzyme activity of cytochromes P450 1A1 and 1A2 in Sprague-Dawley and Wistar rats.
22749033 2012 Role of CYP1A2 polymorphisms on lung cancer risk in a prospective study.
22673010 2012 Changes in CYP1A2 activity in humans after 3,4-methylenedioxymethamphetamine (MDMA, ecstasy) administration using caffeine as a probe drug.
22648710 2012 CYP1A2 and coffee intake and the modifying effect of sex, age, and smoking.
22628494 2013 Heterocyclic amine intake, smoking, cytochrome P450 1A2 and N-acetylation phenotypes, and risk of colorectal adenoma in a multiethnic population.
22492992 2012 Caffeine intake and CYP1A2 variants associated with high caffeine intake protect non-smokers from hypertension.
22466345 2012 Joint effects of smoking and gene variants involved in sex steroid metabolism on hot flashes in late reproductive-age women.
22448362 2011 Effects of CYP1A2 gene polymorphisms on antipyrine CYP1A2-dependent metabolism.
22426036 2012 Genetic polymorphisms of the CYP3A4, CYP3A5, CYP3A7 and CYP1A2 among the Jordanian population.
22336631 2012 Caffeine increases tear volume depending on polymorphisms within the adenosine A2a receptor gene and cytochrome P450 1A2.
22258279 2012 Prediction of drug clearance in a smoking population: modeling the impact of variable cigarette consumption on the induction of CYP1A2.
22246422 2012 Influence of cytochrome P450 oxidoreductase genetic polymorphisms on CYP1A2 activity and inducibility by smoking.
22228482 2012 Scutellarin inhibits cytochrome P450 isoenzyme 1A2 (CYP1A2) in rats.
22141270 2011 [Single nucleotide polymorphisms of CYP1A2 and their correlation with prostate cancer].
22086975 2012 Bioactivation versus detoxication of the urothelial carcinogen aristolochic acid I by human cytochrome P450 1A1 and 1A2.
22072123 Polymorphism in cytochrome P450 1A2 and their interaction with risk factors in determining risk of squamous cell lung carcinoma in men.
21977969 2012 Genetic polymorphism of estrogen metabolizing enzymes in Siberian women with breast cancer.
21929532 2012 Comprehensive cytochrome P450 CYP1A2 gene analysis in French caucasian patients with familial and sporadic porphyria cutanea tarda.
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21825116 2011 Effect of dimethyl sulfoxide on in vitro cytochrome P4501A2 mediated phenacetin O-deethylation in human liver microsomes.
21598960 2011 Long-range effects of a peripheral mutation on the enzymatic activity of cytochrome P450 1A2.
21576599 2011 Cholesterol 25-hydroxylation activity of CYP3A.
21505853 2011 Molecular mechanisms of cold-induced CYP1A activation in rat liver microsomes.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
21480221 2012 Cytochrome P4501A2 phenotype and bladder cancer risk: The Shanghai bladder cancer study.
21357676 2011 Sequence variants at CYP1A1-CYP1A2 and AHR associate with coffee consumption.
21329464 2011 Polymorphism of xenobiotic-metabolizing genes and breast cancer susceptibility in North Indian women.
21281405 2011 Coffee, ADORA2A, and CYP1A2: the caffeine connection in Parkinson's disease.
21262253 2011 Induction of cytochromes P450 1A1 and 1A2 by tanshinones in human HepG2 hepatoma cell line.
21210738 2011 C5-hydroxylation of liquiritigenin is catalyzed selectively by CYP1A2.
21148426 2011 Enhanced clopidogrel responsiveness in smokers: smokers' paradox is dependent on cytochrome P450 CYP1A2 status.
21086794 2010 Development of a high throughput single nucleotide polymorphism screening method for the cytochrome P450 1A2 polymorphisms CYP1A2*1C and CYP1A2*1F: are they useful as predictive markers in mental disorders?
21081473 2011 Genetic variation in the bioactivation pathway for polycyclic hydrocarbons and heterocyclic amines in relation to risk of colorectal neoplasia.
21072184 2010 Flavopiridol pharmacogenetics: clinical and functional evidence for the role of SLCO1B1/OATP1B1 in flavopiridol disposition.
21071160 2011 Analysis of 50 SNPs in CYP2D6, CYP2C19, CYP2C9, CYP3A4 and CYP1A2 by MALDI-TOF mass spectrometry in Chinese Han population.
20970553 2010 Toward personalized medicine in renal transplantation.
20957336 CYP1A2*1F and GSTM1 alleles are associated with susceptibility to porphyria cutanea tarda.
20933493 2011 Simultaneous measurement of CYP1A2 activity, regioselectivity, and coupling: Implications for environmental sensitivity of enzyme-substrate binding.
20930417 2010 Pharmacogenetics of CYP1A2, novel polymorphisms and haplotypes in three distinct Asian populations.
20881513 2010 CYP1A2 is more variable than previously thought: a genomic biography of the gene behind the human drug-metabolizing enzyme.
20853468 2010 Caffeine and paraxanthine HPLC assay for CYP1A2 phenotype assessment using saliva and plasma.
20829355 2010 The aryl hydrocarbon receptor-interacting protein (AIP) is required for dioxin-induced hepatotoxicity but not for the induction of the Cyp1a1 and Cyp1a2 genes.
20806393 Differential mechanisms for the inhibition of human cytochrome P450 1A2 by apigenin and genistein.
20797314 2010 The effect of CYP1A2 gene polymorphisms on Theophylline metabolism and chronic obstructive pulmonary disease in Turkish patients.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20663043 2010 Effects of the aqueous extract from Salvia miltiorrhiza Bunge on caffeine pharmacokinetics and liver microsomal CYP1A2 activity in humans and rats.
20656072 2011 Flexibility of human cytochrome P450 enzymes: molecular dynamics and spectroscopy reveal important function-related variations.
20652353 2010 Genetic polymorphisms related to efficacy and overuse of triptans in chronic migraine.
20641098 2010 Caffeine, selected metabolic gene variants, and risk for neural tube defects.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20602612 2010 Genetic profile of patients with epilepsy on first-line antiepileptic drugs and potential directions for personalized treatment.
20583967 2010 A multi-endpoint evaluation of cytochrome P450 1A2, 2B6 and 3A4 induction response in human hepatocyte cultures after treatment with ?-naphthoflavone, phenobarbital and rifampicin.
20559687 2010 CYP1A2 polymorphisms, occupational and environmental exposures and risk of bladder cancer.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20505544 Effect of hormone metabolism genotypes on steroid hormone levels and menopausal symptoms in a prospective population-based cohort of women experiencing the menopausal transition.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20390257 2010 Induction of CYP1A2 by heavy coffee consumption is associated with the CYP1A2 -163C>A polymorphism.
20389299 2010 Pazopanib-induced hyperbilirubinemia is associated with Gilbert's syndrome UGT1A1 polymorphism.
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20375710 2010 Polymorphisms in xenobiotic metabolizing enzymes and diet influence colorectal adenoma risk.
20304699 2010 Polymorphisms of caffeine metabolism and estrogen receptor genes and risk of Parkinson's disease in men and women.
20218903 2010 Genetic polymorphisms of CYP1A2, CYP3A4, CYP3A5, pregnane/steroid X receptor and constitutive androstane receptor in 207 healthy Spanish volunteers.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20213484 2010 Frequencies of genetic polymorphisms related to triptans metabolism in chronic migraine.
20175915 2010 Coffee consumption and CYP1A2 genotype in relation to bone mineral density of the proximal femur in elderly men and women: a cohort study.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20163457 2010 Smoking but not homozygosity for CYP1A2 g-163A allelic variant leads to earlier disease onset in patients with sporadic porphyria cutanea tarda.
20147896 2010 A phenotype-genotype approach to predicting CYP450 and P-glycoprotein drug interactions with the mixed inhibitor/inducer tipranavir/ritonavir.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20131310 2010 Genetic polymorphisms in cytochrome P450s, GSTs, NATs, alcohol consumption and risk of non-Hodgkin lymphoma.
20125119 2010 Functional characterization of eight human cytochrome P450 1A2 gene variants by recombinant protein expression.
20118554 2010 Effects of cigarette smoking and cytochrome P450 2D6 genotype on fluvoxamine concentration in plasma of Japanese patients.
20080081 2010 CYP1A1, CYP1A2 and CYBA gene polymorphisms associated with oxidative stress in COPD.
20054636 2010 Lack of association of CYP1A2-164 A/C polymorphism with breast cancer susceptibility: a meta-analysis involving 17,600 subjects.
20047124 2009 Association between dietary heterocyclic amine levels, genetic polymorphisms of NAT2, CYP1A1, and CYP1A2 and risk of stomach cancer: a hospital-based case-control study in Japan.
20043572 2009 Drug metabolizing enzyme CYP1A2 status in pediatric patients with hemoglobin E-beta thalassemia.
20029944 2010 Genetic polymorphisms in the metabolic pathway and non-Hodgkin lymphoma survival.
19961320 2010 Structure, function, regulation and polymorphism and the clinical significance of human cytochrome P450 1A2.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19926050 2009 Pharmacogenetic testing for clopidogrel using the rapid INFINITI analyzer: a dose-escalation study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19860743 2010 Effect of gene-environment Interactions on mental development in African American, Dominican, and Caucasian mothers and newborns.
19843669 2009 CYP1A2, GSTM1, and GSTT1 polymorphisms and diet effects on CYP1A2 activity in a crossover feeding trial.
19823875 2010 Molecular genetics and epigenetics of the cytochrome P450 gene family and its relevance for cancer risk and treatment.
19822571 2009 Genetic variations in xenobiotic metabolic pathway genes, personal hair dye use, and risk of non-Hodgkin lymphoma.
19806921 2009 [Population pharmacokinetics research of clozapine in Chinese schizophrenic patients].
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19776291 2010 Association of testicular germ cell tumor with polymorphisms in estrogen receptor and steroid metabolism genes.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19682433 2010 Constitutive androstane receptor transcriptionally activates human CYP1A1 and CYP1A2 genes through a common regulatory element in the 5'-flanking region.
19666078 2009 CYP1-mediated antiproliferative activity of dietary flavonoids in MDA-MB-468 breast cancer cells.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19643819 2009 Interaction between cytochrome P450 1A2 genetic polymorphism and cigarette smoking on the risk of hepatocellular carcinoma in a Japanese population.
19636338 2010 Pharmacogenetics and olanzapine treatment: CYP1A2*1F and serotonergic polymorphisms influence therapeutic outcome.
19605743 2009 Dihydroorotate dehydrogenase polymorphism influences the toxicity of leflunomide treatment in patients with rheumatoid arthritis.
19593168 2009 ABCB1 and cytochrome P450 polymorphisms: clinical pharmacogenetics of clozapine.
19593158 2009 Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes are not associated with response and remission in a sample of depressive patients.
19583676 2009 Comparison of linkage disequilibrium patterns and haplotype structure of eight single nucleotide polymorphisms across the CYP1A2 gene between the Korean, and other populations registered in the International HapMap database.
19576320 2009 Relation of genetic polymorphisms in the cytochrome P450 gene with clopidogrel resistance after drug-eluting stent implantation in Koreans.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19571439 2009 Functional analysis of GC Box and its CpG methylation in the regulation of CYP1A2 gene expression.
19569730 2009 CYP1A2 is the major isoform responsible for paeonol O-demethylation in human liver microsomes.
19534587 2009 Effect of sodium tanshinone II A sulfonate on the activity of CYP1A2 in healthy volunteers.
19507017 2009 Genetic polymorphisms of cytochrome p450 and matrix metalloproteinase in chronic obstructive pulmonary disease.
19479063 2009 Phase I metabolic genes and risk of lung cancer: multiple polymorphisms and mRNA expression.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19452301 2009 Association between dietary heterocyclic amine levels, genetic polymorphisms of NAT2, CYP1A1, and CYP1A2 and risk of colorectal cancer: a hospital-based case-control study in Japan.
19451835 2009 CYP1A2 genotype modifies the association between coffee intake and the risk of hypertension.
19450128 2009 Influence of genetic polymorphisms, smoking, gender and age on CYP1A2 activity in a Turkish population.
19442564 2009 CYP1A2*1C, CYP2E1*5B, and GSTM1 polymorphisms are predictors of risk and poor outcome in head and neck squamous cell carcinoma patients.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19414633 2009 Cytochrome P450 genetic polymorphisms and the response to prasugrel: relationship to pharmacokinetic, pharmacodynamic, and clinical outcomes.
19356113 2009 Utility of Nicotiana tabacum cell suspension cultures expressing human CYP1A1, CYP1A2 and CYP3A4 to study the oxidative metabolism of the herbicide 14C-fluometuron.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19338043 2009 Genetic polymorphisms in glutathione S-transferases and cytochrome P450s, tobacco smoking, and risk of non-Hodgkin lymphoma.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19332078 2009 CYP1A2 genetic polymorphisms and adenocarcinoma lung cancer risk in the Tunisian population.
19307236 2009 Aromatic DNA adducts and polymorphisms in metabolic genes in healthy adults: findings from the EPIC-Spain cohort.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19285097 2009 CYP1A1 and CYP1A2 expression: comparing 'humanized' mouse lines and wild-type mice; comparing human and mouse hepatoma-derived cell lines.
19276377 2009 CYP1A1/2 haplotypes and lung cancer and assessment of confounding by population stratification.
19274061 2009 Allele-specific expression and gene methylation in the control of CYP1A2 mRNA level in human livers.
19273964 2009 Polymorphisms of cytochrome P450 1A2 and N-acetyltransferase genes, meat consumption, and risk of colorectal cancer.
19229255 2009 Genetic polymorphisms in estrogen metabolism and breast cancer risk in case-control studies in Japanese, Japanese Brazilians and non-Japanese Brazilians.
19219744 2009 Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes.
19106084 2009 Cytochrome p-450 polymorphisms and response to clopidogrel.
19095219 2009 Variation in catechol-O-methyltransferase is associated with duloxetine response in a clinical trial for major depressive disorder.
19029318 2009 Comprehensive in vitro analysis of voriconazole inhibition of eight cytochrome P450 (CYP) enzymes: major effect on CYPs 2B6, 2C9, 2C19, and 3A.
19026171 2008 Determination of the inhibitory potential of 6 fluoroquinolones on CYP1A2 and CYP2C9 in human liver microsomes.
19000940 2008 Correlates of response to Olanzapine in a North Indian Schizophrenia sample.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18990750 2008 Red meat intake, doneness, polymorphisms in genes that encode carcinogen-metabolizing enzymes, and colorectal cancer risk.
18941913 2009 Coffee intake, variants in genes involved in caffeine metabolism, and the risk of epithelial ovarian cancer.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18850169 2007 Coffee, CYP1A2 genotype and risk of myocardial infarction.
18840375 2008 Six-month, prospective, longitudinal, open-label caffeine and dextromethorphan phenotyping study in children with growth hormone deficiency receiving recombinant human growth hormone replacement.
18825963 2008 Frequencies of four genetic polymorphisms in the CYP1A2 gene in Turkish population.
18813311 2008 Coffee intake and CYP1A2*1F genotype predict breast volume in young women: implications for breast cancer.
18801337 2008 Lysophosphatidylserine-induced functional switch of human cytochrome P450 1A2 and 2E1 from monooxygenase to phospholipase D.
18798002 2009 Coffee consumption, genetic susceptibility and bladder cancer risk.
18784359 2008 Polymorphisms in phase I and phase II metabolism genes and risk of chronic benzene poisoning in a Chinese occupational population.
18759349 2008 Coffee, caffeine-related genes, and Parkinson's disease: a case-control study.
18751408 CYP1A2 164 A-->C polymorphism, cigarette smoking, consumption of well-done red meat and risk of developing colorectal adenomas and carcinomas.
18703023 2008 Comparison of CYP1A2 and NAT2 phenotypes between black and white smokers.
18690546 2009 CYP1A2, CYP2D6, GSTM1, GSTP1, and GSTT1 gene polymorphisms in patients with bladder cancer in a Turkish population.
18632753 2008 Bladder cancer risk and genetic variation in AKR1C3 and other metabolizing genes.
18628519 2008 Synergism between oral estrogen therapy and cytochrome P450 3A5*1 allele on the risk of venous thromboembolism among postmenopausal women.
18619574 2008 The relative contribution of human cytochrome P450 isoforms to the four caffeine oxidation pathways: an in vitro comparative study with cDNA-expressed P450s including CYP2C isoforms.
18569587 2008 Association between genetic polymorphisms in styrene-metabolizing enzymes and biomarkers in styrene-exposed workers.
18551037 2008 Pharmacogenetics of P450 oxidoreductase: effect of sequence variants on activities of CYP1A2 and CYP2C19.
18544563 2008 Genetic determinants in the metabolism of bladder carcinogens in relation to risk of bladder cancer.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18499698 2008 Interaction of the cytochrome P4501A2, SULT1A1 and NAT gene polymorphisms with smoking and dietary mutagen intake in modification of the risk of pancreatic cancer.
18497059 2008 Comparative analysis of SNP in estrogen-metabolizing enzymes for ovarian, endometrial, and breast cancers in Novosibirsk, Russia.
18496682 2008 Genetic polymorphism of CYP1A2 and the toxicity of leflunomide treatment in rheumatoid arthritis patients.
18493746 2008 Pharmacologic profiling of human and rat cytochrome P450 1A1 and 1A2 induction and competition.
18490497 2008 The effect of oral contraceptives on the pharmacokinetics of melatonin in healthy subjects with CYP1A2 g.-163C>A polymorphism.
18466106 2008 Variation in CYP1A2 activity and its clinical implications: influence of environmental factors and genetic polymorphisms.
18455494 2008 Impairment of human CYP1A2-mediated xenobiotic metabolism by Antley-Bixler syndrome variants of cytochrome P450 oxidoreductase.
18398030 2008 Coffee consumption and CYP1A2*1F genotype modify age at breast cancer diagnosis and estrogen receptor status.
18389617 [Association of cytochrome P450 genes polymorphisms (CYP1A1 and CYP1A2) with the development of chronic obstructive pulmonary disease in Bashkortostan].
18356043 2008 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone.
18318428 2008 CYP1A1, SULT1A1, and SULT1E1 polymorphisms are risk factors for endometrial cancer susceptibility.
18268115 2008 Meat intake, heterocyclic amine exposure, and metabolizing enzyme polymorphisms in relation to colorectal polyp risk.
18231117 2008 Pharmacokinetics/genotype associations for major cytochrome P450 enzymes in native and first- and third-generation Japanese populations: comparison with Korean, Chinese, and Caucasian populations.
18223460 2008 The relationship between the response of clinical symptoms and plasma olanzapine concentration, based on pharmacogenetics: Juntendo University Schizophrenia Projects (JUSP).
18200441 2008 Genetic polymorphisms of cytochrome P450 CYP1A1 (*2A) and microsomal epoxide hydrolase gene, interactions with tobacco-users, and susceptibility to bladder cancer: a study from North India.
18187423 2008 Cooperativity in oxidation reactions catalyzed by cytochrome P450 1A2: highly cooperative pyrene hydroxylation and multiphasic kinetics of ligand binding.
18180754 2008 Antipsychotic-induced tardive dyskinesia and polymorphic variations in COMT, DRD2, CYP1A2 and MnSOD genes: a meta-analysis of pharmacogenetic interactions.
18159984 Association of CYP1A1, CYP1A2, GSTM1 and NAT2 gene polymorphisms with colorectal cancer and smoking.
18077912 2007 [Genotype analysis of CYP1A2 IVS4 + 43A/G in patients with prostate cancer].
18075470 2007 Association between caffeine intake and risk of Parkinson's disease among fast and slow metabolizers.
18052847 2007 Development of in vitro methods to predict induction of CYP1A2 and CYP3A4 in humans.
17900275 2007 Common polymorphisms of CYP2C19 and CYP2C9 affect the pharmacokinetic and pharmacodynamic response to clopidogrel but not prasugrel.
17852022 2007 Riluzole metabolism and CYP1A1/2 polymorphisms in patients with ALS.
17823234 2007 Progress curve analysis of CYP1A2 inhibition: a more informative approach to the assessment of mechanism-based inactivation?
17823232 2007 A shuffled CYP1A library shows both structural integrity and functional diversity.
17695473 Association between allelic polymorphisms of metabolizing enzymes (CYP 1A1, CYP 1A2, CYP 2E1, mEH) and occurrence of colorectal cancer in Hungary.
17688403 2007 Association of serotonin 2A receptor and lack of association of CYP1A2 gene polymorphism with tardive dyskinesia in a Turkish population.
17635176 2007 Genetic polymorphism of cytochrome P450s and P-glycoprotein in the Finnish population.
17627011 2007 Combinations of cytochrome P450 gene polymorphisms enhancing the risk for sporadic colorectal cancer related to red meat consumption.
17616786 2007 Genetic polymorphism of the adenosine A2A receptor is associated with habitual caffeine consumption.
17615053 2007 Polymorphisms in the cytochrome P450 genes CYP1A2, CYP1B1, CYP3A4, CYP3A5, CYP11A1, CYP17A1, CYP19A1 and colorectal cancer risk.
17611010 2007 Functional polymorphisms of the cytochrome P450 1A2 (CYP1A2) gene and prolonged QTc interval in schizophrenia.
17603900 2007 Case-only study of interactions between metabolic enzymes and smoking in colorectal cancer.
17603224 2007 CYP1A2 F21L and F186L polymorphisms in an Italian population sample.
17564586 2007 Caffeine intake and small-for-gestational-age birth: modifying effects of xenobiotic-metabolising genes and smoking.
17509724 2007 Interaction between CYP1A2-T2467DELT polymorphism and smoking in adenocarcinoma and squamous cell carcinoma of the lung.
17507624 2007 Evaluation of genetic variations in the androgen and estrogen metabolic pathways as risk factors for sporadic and familial prostate cancer.
17507615 2007 The CYP1A2 genotype modifies the association between coffee consumption and breast cancer risk among BRCA1 mutation carriers.
17503978 2007 Impact of CYP1A2 and CYP2D6 polymorphisms on drug metabolism and on insulin and lipid elevations and insulin resistance in clozapine-treated patients.
17498780 2007 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers.
17477782 NAT2 and CYP1A2 polymorphisms and lung cancer risk in relation to smoking status.
17429315 2007 Genetic polymorphisms in estrogen-metabolizing genes and breast cancer survival.
17418993 2007 Development and full validation of six inhibition assays for five major cytochrome P450 enzymes in human liver microsomes using an automated 96-well microplate incubation format and LC-MS/MS analysis.
17372239 2007 Pairwise combinations of estrogen metabolism genotypes in postmenopausal breast cancer etiology.
17370067 2007 Comparisons of CYP1A2 genetic polymorphisms, enzyme activity and the genotype-phenotype relationship in Swedes and Koreans.
17363580 2007 Association of CYP1B1 germ line mutations with hepatocyte nuclear factor 1alpha-mutated hepatocellular adenoma.
17345072 2007 No effect of the CYP1A2*1F genotype on thioridazine, mesoridazine, sulforidazine plasma concentrations in psychiatric patients.
17311915 2007 Adaptations for the oxidation of polycyclic aromatic hydrocarbons exhibited by the structure of human P450 1A2.
17295924 2007 Breast density and polymorphisms in genes coding for CYP1A2 and COMT: the Multiethnic Cohort.
17259654 2007 Development of lung cancer before the age of 50: the role of xenobiotic metabolizing genes.
17191090 2007 Association between polymorphisms of biotransformation and DNA-repair genes and risk of colorectal cancer in Taiwan.
17178267 2006 ABCB1 and cytochrome P450 genotypes and phenotypes: influence on methadone plasma levels and response to treatment.
17164366 2006 Polymorphisms in metabolic genes related to tobacco smoke and the risk of gastric cancer in the European prospective investigation into cancer and nutrition.
17065585 2006 Effect of diet on the development of drug metabolism by cytochrome P-450 enzymes in healthy infants.
16985250 2006 Estrogen sulfation genes, hormone replacement therapy, and endometrial cancer risk.
16985026 2006 Metabolic gene variants and risk of non-Hodgkin's lymphoma.
16969362 2007 Genetic susceptibility to Tardive Dyskinesia in chronic schizophrenia subjects: V. Association of CYP1A2 1545 C>T polymorphism.
16933202 CYP1A2 polymorphism (C > A at position -163) in Ovambos, Koreans and Mongolians.
16882880 2006 Transcriptional activation of CYP2C9, CYP1A1, and CYP1A2 by hepatocyte nuclear factor 4alpha requires coactivators peroxisomal proliferator activated receptor-gamma coactivator 1alpha and steroid receptor coactivator 1.
16864595 2007 The influence of genetic polymorphisms in Ahr, CYP1A1, CYP1A2, CYP1B1, GST M1, GST T1 and UGT1A1 on urine 1-hydroxypyrene glucuronide concentrations in healthy subjects from Rio Grande do Sul, Brazil.
16800822 2006 Effects of genetic polymorphisms of MDR1, FMO3 and CYP1A2 on susceptibility to colorectal cancer in Koreans.
16782969 2006 Stillbirth and slow metabolizers of caffeine: comparison by genotypes.
16775389 2006 Association study between functional polymorphisms in the cytochrome P450 1A2 and 2D6 genes and polydipsia in schizophrenia.
16772608 2006 Cytochrome P450 2C19 loss-of-function polymorphism is a major determinant of clopidogrel responsiveness in healthy subjects.
16740387 2006 Hair dye use is not associated with risk for bladder cancer: evidence from a case-control study in Spain.
16636061 2006 For dioxin-induced birth defects, mouse or human CYP1A2 in maternal liver protects whereas mouse CYP1A1 and CYP1B1 are inconsequential.
16609368 2006 Search for an association between the human CYP1A2 genotype and CYP1A2 metabolic phenotype.
16538176 2006 Genetic susceptibility to carbamazepine-induced cutaneous adverse drug reactions.
16538170 2006 Population-based case-control study of AhR (aryl hydrocarbon receptor) and CYP1A2 polymorphisms and breast cancer risk.
16522833 2006 Coffee, CYP1A2 genotype, and risk of myocardial infarction.
16505155 2006 A common regulatory region functions bidirectionally in transcriptional activation of the human CYP1A1 and CYP1A2 genes.
16495781 2006 Association of CYP1A2 genetic polymorphisms with hepatocellular carcinoma susceptibility: a case-control study in a high-risk region of China.
16471212 2005 [A case-control study on the association between genetic polymorphisms of metabolic enzymes and the risk of colorectal cancer].
16426572 2006 Preferential inducibility of CYP1A1 and CYP1A2 by TCDD: differential regulation in primary human hepatocytes versus transformed human cells.
16406813 2007 Effect of urban traffic, individual habits, and genetic polymorphisms on background urinary 1-hydroxypyrene excretion.
16402549 Metabolism of 4-n-nonylphenol by non-modified and CYP1A1- and CYP1A2-transgenic cell cultures of tobacco.
16402077 Estrogen-metabolizing gene polymorphisms in the assessment of female hormone-dependent cancer risk.
16401082 2006 Radical intermediates in the catalytic oxidation of hydrocarbons by bacterial and human cytochrome P450 enzymes.
16385402 2006 Phenotype-genotype analysis of CYP1A2 in Japanese patients receiving oral theophylline therapy.
16324277 2005 [The combined effect of isoniazid and rifampicin on the activities of CYP4501A2 and CYP4503A4 in primary hepatocytes from healthy human adults].
16307269 2005 Rapid genotyping for relevant CYP1A2 alleles by pyrosequencing.
16204462 2006 Expression of cytochromes P450, conjugating enzymes and nuclear receptors in human hepatoma HepaRG cells.
16188490 2005 Influence of the genetic polymorphism in the 5'-noncoding region of the CYP1A2 gene on CYP1A2 phenotype and urinary mutagenicity in smokers.
16172230 2005 Risk of testicular germ cell cancer in relation to variation in maternal and offspring cytochrome p450 genes involved in catechol estrogen metabolism.
16157215 2005 The CYP1A2-164A-->C polymorphism (CYP1A2*1F) is associated with the risk for colorectal adenomas in humans.
16153396 2005 The G-113A polymorphism in CYP1A2 affects the caffeine metabolic ratio in a Chinese population.
16130011 2005 Estrogen-metabolizing gene polymorphisms and lipid levels in women with different hormonal status.
16103451 2005 Estrogen metabolism-related genes and breast cancer risk: the multiethnic cohort study.
16048566 2005 Genetic polymorphisms of cytochrome P450 in patients with hepatitis C virus-associated hepatocellular carcinoma.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15996939 2005 The CYP1A1*2a allele is an independent prognostic factor for acute myeloid leukemia.
15987714 2006 Polymorphisms of cytochrome P4501A2 and N-acetyltransferase genes, smoking, and risk of pancreatic cancer.
15949157 2005 The cytochrome P450 CYP1A2 genetic polymorphisms *1F and *1D do not affect clozapine clearance in a group of schizophrenic patients.
15941966 2005 Association of genetic polymorphisms with serum estrogens measured multiple times during a 2-year period in premenopausal women.
15901993 2005 Association between genetic polymorphisms of CYP1A2, arylamine N-acetyltransferase 1 and 2 and susceptibility to cholangiocarcinoma.
15890241 2005 NAT2 fast acetylator genotype is associated with an increased risk of lung cancer among never-smoking women in Taiwan.
15849225 2005 Caffeine intake, CYP1A2 polymorphism and the risk of recurrent pregnancy loss.
15774926 2005 Association study of detoxification genes in age related macular degeneration.
15770072 2005 Single nucleotide polymorphisms and haplotypes of CYP1A2 in a Japanese population.
15763632 2005 CYP1A2 phenotype and genotype in a population from the Carboniferous Region of Coahuila, Mexico.
15734958 2005 Genetic factors in catechol estrogen metabolism in relation to the risk of endometrial cancer.
15680923 2005 Interactions of mammalian cytochrome P450, NADPH-cytochrome P450 reductase, and cytochrome b(5) enzymes.
15643613 2005 Toward the evaluation of function in genetic variability: characterizing human SNP frequencies and establishing BAC-transgenic mice carrying the human CYP1A1_CYP1A2 locus.
15564895 2004 Genetic association analysis of functional polymorphisms in the cytochrome P450 1A2 (CYP1A2) gene with tardive dyskinesia in Japanese patients with schizophrenia.
15519301 2004 Enhancement of 7-methoxyresorufin O-demethylation activity of human cytochrome P450 1A2 by molecular breeding.
15505641 2005 Genetic susceptibility to tardive dyskinesia in chronic schizophrenia subjects: I. Association of CYP1A2 gene polymorphism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469410 2004 Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
15466009 2004 Genetic polymorphism of CYP1A2 increases the risk of myocardial infarction.
15387446 2004 Frequency of -163 C>A and 63 C>G single nucleotide polymorphism of cytochrome P450 1A2 in two African populations.
15382051 2004 An investigation of mammographic density and gene variants in healthy women.
15363478 2004 No association between polymorphisms in three genes of cytochrome p450 family and paranoid schizophrenia in northern Chinese Han population.
15349722 2004 Intragraft iNOS induction during human liver allograft rejection depresses cytochrome p450 activity.
15327587 2004 Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro.
15299091 2004 Ah receptor, CYP1A1, CYP1A2 and CYP1B1 gene polymorphisms are not involved in the risk of recurrent pregnancy loss.
15241822 2004 Estrogen-metabolizing gene polymorphisms in the assessment of breast carcinoma risk and fibroadenoma risk in Caucasian women.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15110095 2004 CYP1A2 and NAT2 genotype/phenotype relations and urinary excretion of 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) in a human dietary intervention study.
15039299 2004 Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes.
14976127 2004 Low CYP1A2 activity associated with testicular cancer.
14725854 2004 Functional characterization of four allelic variants of human cytochrome P450 1A2.
14723376 2003 Atovaquone/proguanil resistance in Africa: a case report.
14714565 2003 Cytochrome p450A1 polymorphisms in a Caucasian population with porphyria cutanea tarda.
14695651 Genotype and allele frequencies of polymorphic cytochromes P450 CYP1A2 and CYP2E1 in Mexicans.
14648207 2004 Cytochrome P450 (CYP) 1A2, sulfotransferase (SULT) 1A1, and N-acetyltransferase (NAT) 2 polymorphisms and susceptibility to urothelial cancer.
14640293 2003 Pharmacogenomics as an aspect of molecular autopsy for forensic pathology/toxicology: does genotyping CYP 2D6 serve as an adjunct for certifying methadone toxicity?
14563787 2004 Six novel nonsynonymous CYP1A2 gene polymorphisms: catalytic activities of the naturally occurring variant enzymes.
12943470 2003 High-speed genotyping of CYP1A2*1F mutation with fluorescent hybridization probes using the LightCycler.
12925300 2003 Association of caffeine intake and CYP1A2 genotype with ovarian cancer.
12920202 2003 Genetic polymorphism of CYP1A2 in Ethiopians affecting induction and expression: characterization of novel haplotypes with single-nucleotide polymorphisms in intron 1.
12900870 2003 Capillary electrophoresis to assess drug metabolism induced in vitro using single CYP450 enzymes (Supersomes): application to the chiral metabolism of mephenytoin and methadone.
12851801 2003 Determination of -3858G-->A and -164C-->A genetic polymorphisms of CYP1A2 in blood and saliva by rapid allelic discrimination: large difference in the prevalence of the -3858G-->A mutation between Caucasians and Asians.
12790158 2003 Smoking and tardive dyskinesia: lack of involvement of the CYP1A2 gene.
12732846 2003 Polymorphisms in the CYP1A2 gene and theophylline metabolism in patients with asthma.
12692107 2003 The CYP3A4*1B variant is related to the onset of puberty, a known risk factor for the development of breast cancer.
12663508 2003 Permanent hair dyes and bladder cancer: risk modification by cytochrome P4501A2 and N-acetyltransferases 1 and 2.
12630986 2003 Genotyping of four genetic polymorphisms in the CYP1A2 gene in the Egyptian population.
12618594 2003 The effect of smoking and cytochrome P450 CYP1A2 genetic polymorphism on clozapine clearance and dose requirement.
12569554 2003 CYP enzyme polymorphisms and susceptibility to HCV-related chronic liver disease and liver cancer.
12566081 2003 Uroporphyrin accumulation in hepatoma cells expressing human or mouse CYP1A2: relation to the role of CYP1A2 in human porphyria cutanea tarda.
12534642 2003 Polymorphisms in the cytochrome P450 CYP1A2 gene (CYP1A2) in colorectal cancer patients and controls: allele frequencies, linkage disequilibrium and influence on caffeine metabolism.
12484238 2002 Meat intake, metabolic genes and colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445035 2002 Inducibility of CYP1A2 by omeprazole in vivo related to the genetic polymorphism of CYP1A2.
12445029 2002 The effect of the CYP1A2 *1F mutation on CYP1A2 inducibility in pregnant women.
12419832 2002 A pharmacogenetic study to investigate the role of dietary carcinogens in the etiology of colorectal cancer.
12181774 2002 DNA sequence variation in a 3.7-kb noncoding sequence 5' of the CYP1A2 gene: implications for human population history and natural selection.
12147246 2002 Characterization of human CYP1A1/1A2 induction by DNA microarray and alpha-naphthoflavone.
12067576 2002 Role of metabolic polymorphisms NAT2 and CYP1A2 on urinary mutagenicity after a pan-fried hamburger meal.
11943609 2002 Analyses of bulky DNA adduct levels in human breast tissue and genetic polymorphisms of cytochromes P450 (CYPs), myeloperoxidase (MPO), quinone oxidoreductase (NQO1), and glutathione S-transferases (GSTs).
11817502 2002 Lack of impact of CYP1A2 genetic polymorphism (C/A polymorphism at position 734 in intron 1 and G/A polymorphism at position -2964 in the 5'-flanking region of CYP1A2) on the plasma concentration of haloperidol in smoking male Japanese with schizophrenia.
11791895 2001 The major fluvoxamine metabolite in urine is formed by CYP2D6.
11782366 2002 Comparative aflatoxin B(1) activation and cytotoxicity in human bronchial cells expressing cytochromes P450 1A2 and 3A4.
11763009 2001 Treatment-resistance to clozapine in association with ultrarapid CYP1A2 activity and the C-->A polymorphism in intron 1 of the CYP1A2 gene: effect of grapefruit juice and low-dose fluvoxamine.
11749050 2001 CYP gene polymorphisms and early menarche.
11511187 2001 Human enzymes involved in the metabolic activation of carcinogenic aristolochic acids: evidence for reductive activation by cytochromes P450 1A1 and 1A2.
11507974 2001 Genetic polymorphisms of CYP1A1, GSTM1 and P53 genes in a unique Siberian population of Tundra Nentsi and its pharmacogenetic importance.
11501059 2000 G-2964A and C734A genetic polymorphisms of CYP1A2 in Chinese population.
11496364 2001 Lack of association between a functional polymorphism of the cytochrome P450 1A2 (CYP1A2) gene and tardive dyskinesia in schizophrenia.
11470995 2001 Plasma caffeine metabolite ratio (17X/137X) in vivo associated with G-2964A and C734A polymorphisms of human CYP1A2.
11393588 2001 Effects of genetic polymorphism of CYP1A2 inducibility on the steady-state plasma concentrations of trazodone and its active metabolite m-chlorophenylpiperazine in depressed Japanese patients.
11295848 2001 Five novel natural allelic variants-951A>C, 1042G>A (D348N), 1156A>T (I386F), 1217G>A (C406Y) and 1291C>T (C431Y)-of the human CYP1A2 gene in a French Caucasian population.
11275366 2001 Genetic polymorphisms in cytochrome P450 (CYP) 1A1, CYP1A2, CYP2E1, glutathione S-transferase (GST) M1 and GSTT1 and susceptibility to prostate cancer in the Japanese population.
11207026 2001 Organization of the CYP1A cluster on human chromosome 15: implications for gene regulation.
11186132 2000 Identification of novel polymorphisms in the 5' flanking region of CYP1A2, characterization of interethnic variability, and investigation of their functional significance.
11153915 2000 Association between CYP1A2 polymorphism and susceptibility to porphyria cutanea tarda.
10791558 2000 N-acetyltransferase polymorphisms and colorectal cancer: a HuGE review.
10493258 1999 Human cytochrome P4501A2.
10463577 1999 Mutagenic activation of environmental carcinogens by microsomes of gastric mucosa with intestinal metaplasia.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
9884316 1999 Detection of a novel cytochrome P-450 1A2 polymorphism (F21L) in Chinese.
9797707 1998 Characterisation of xenobiotic-metabolising enzyme expression in human bronchial mucosa and peripheral lung tissues.
9598815 1998 Up-regulation of cytochrome P450 1A2, 2C9, and 2E1 in chronic pancreatitis.
8694864 1996 Detection of cytochrome P450 gene expression in human placenta in first trimester of pregnancy.
8573198 1996 7-Ethoxycoumarin O-deethylation catalyzed by cytochromes P450 1A2 and 2E1 in human liver microsomes.
8553685 1995 Determination of P4501A2 activity in human liver microsomes using [3-14C-methyl]caffeine.
8287062 1993 Expression of CYP1A1 and CYP1A2 genes in human liver.
3755823 1986 Human P3(450): cDNA and complete amino acid sequence.
3681487 1987 Human P(3)450: cDNA and complete protein sequence, repetitive Alu sequences in the 3' nontranslated region, and localization of gene to chromosome 15.
3517618 1986 Identification of a human liver cytochrome P-450 homologous to the major isosafrole-inducible cytochrome P-450 in the rat.
3462722 1986 Human cytochrome P-450 4 mRNA and gene: part of a multigene family that contains Alu sequences in its mRNA.
3000715 1985 Cloning and isolation of human cytochrome P-450 cDNAs homologous to dioxin-inducible rabbit mRNAs encoding P-450 4 and P-450 6.
2813353 1989 Human cytochrome P-450PA (P-450IA2), the phenacetin O-deethylase, is primarily responsible for the hepatic 3-demethylation of caffeine and N-oxidation of carcinogenic arylamines.
2575218 1989 Human CYP1A2: sequence, gene structure, comparison with the mouse and rat orthologous gene, and differences in liver 1A2 mRNA expression.