Property Summary

Ligand Count 94
NCBI Gene PubMed Count 544
PubMed Score 3209.33
PubTator Score 5596.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
osteosarcoma 7950 7.5e-13
Waldenstrons macroglobulinemia 765 8.8e-03
sarcoidosis 370 9.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -7.642 7.5e-13
sarcoidosis 1.100 9.2e-03
Waldenstrons macroglobulinemia 3.390 8.8e-03

Gene RIF (559)

AA Sequence

MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAK      1 - 70
QLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNV     71 - 140
TDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLP    141 - 210
YGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVN    211 - 280
CETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLA    281 - 350
RNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL    351 - 420
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRI    421 - 490
ANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQ    491 - 560
NQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKL    561 - 630
MEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLP    631 - 700
RIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS                             701 - 745
//

Text Mined References (550)

PMID Year Title