Property Summary

NCBI Gene PubMed Count 511
Grant Count 846
R01 Count 415
Funding $140,191,291.56
PubMed Score 2949.16
PubTator Score 5596.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (62)

Disease Z-score Confidence
Vasculitis 64 6.885 3.4
Wegener's granulomatosis 14 6.554 3.3
Colitis 46 6.192 3.1
Lung disease 132 5.068 2.5
Kidney disease 396 5.034 2.5
Pancreatitis 97 4.729 2.4
Cancer 2,346 4.669 2.3
Coronary artery disease 240 4.449 2.2
Atherosclerosis 275 4.197 2.1
Asthma 349 3.955 2.0
Crohn's disease 304 3.942 2.0
Pleurisy 18 3.828 1.9
Arthritis 248 3.819 1.9
Lupus erythematosus 80 3.766 1.9
Cerebrovascular disease 231 3.716 1.9
Diarrhea 155 3.617 1.8
Peritonitis 37 3.548 1.8
Periodontal disease 37 3.541 1.8
Purpura 17 3.474 1.7
Brain edema 26 3.422 1.7
Anemia 252 3.415 1.7
Common cold 63 3.368 1.7
Bronchitis 44 3.336 1.7
cystic fibrosis 1,665 3.264 1.6
Mastitis 48 3.225 1.6
Ileus 11 3.194 1.6
Neutropenia 78 3.184 1.6
Keratitis 42 3.075 1.5
Skin disease 65 3.075 1.5
Henoch-Schoenlein purpura 13 3.072 1.5
Acute kidney injury 65
Alzheimer's disease 644
Anoxia 33
Arthritis, Experimental 39
Bladder Neoplasm 109
Brain Diseases 22
Brain Ischemia 87
Carcinoma 2,147 1.0
Cardiovascular Diseases 50
Diabetes Mellitus, Experimental 106
Drug Eruptions 18
Infection by Trichuris trichiura 2
Inflammation 109
Keratosis 34
Kidney Diseases 86
Liver Cirrhosis, Alcoholic 16
Liver carcinoma 217
Lung Neoplasms 171
Lung diseases 48
Major Depressive Disorder 106
Myeloperoxidase Deficiency 1
Occupational Diseases 8
Precancerous Conditions 69
Prostatic Neoplasms 471
Reperfusion Injury 84
Rheumatoid Arthritis 1,160
Shock, Hemorrhagic 7
Urticaria 53
Waldenstrons macroglobulinemia 765
osteosarcoma 7,933
sarcoidosis 358
ulcerative colitis 2,087

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 4.231 0.001
osteosarcoma -7.642 0.000
sarcoidosis 1.100 0.009

Synonym

Accession P05164 A1L4B8 Q14862 Q4PJH5 Q9UCL7 MPO
Symbols

Gene

MPO

PANTHER Protein Class (2)

PDB

4EJX   1CXP   1D2V   1D5L   1D7W   1DNU   1DNW   1MHL   1MYP   3F9P   3ZS0   3ZS1   4C1M   4DL1   5FIW  

Gene RIF (526)

PMID Text
26841645 Subgroup 3 showed the most marked reduction in lymphocyte numbers in the areas of inflammation, which was accompanied by a significant increase in the relative density and other morphometric parameters of MPO-positive macrophages and granulocytes
26797862 High serum levels of MPO were observed in obese individuals with hs-CRP above 3 mg/L, which is a classic biomarker for inflammation and cardiovascular risk
26714302 These findings suggest that MPO functions as a mediator of novel regulatory mechanism in microcirculation, indicating the influence of MPO-induced abnormalities on RBC deformability under pathological stress conditions.
26576922 concentrations of the C-reactive protein, myeloperoxidase and soluble CD40 ligand taken from peripheral vein were closely similar to the concentration found in coronary blood of ACS patients
26567811 Results suggest MPO as a powerful indicator of instability and could have a prognostic impact in coronary artery disease.
26541603 MPO levels were positively associated with obesity. MPO levels were positively associated with obesity indices (BMI z-score, WHtR and %BFM). Higher MPO levels were associated with higher mean arterial pressure, with nondipping and with insulin resistance.
26431910 Myeloperoxidase gene polymorphism showed protective effect in Russian population diagnosed with essential hypertension.
26392121 higher baseline levels in patients with autoimmune inner ear disease
26386352 Myeloperoxidase and eosinophil peroxidase are readily internalized by HUVEC cells where they promote cellular proliferation, migration, invasion, and stimulate angiogenesis both in vitro and in vivo.
26323935 People with myeloperoxidase 463G>A polymorphisms (AA genetic type) may have decreased lung cancer risk under dominant genetic model (meta-analysis).
More...

AA Sequence

MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAK      1 - 70
QLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNV     71 - 140
TDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLP    141 - 210
YGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVN    211 - 280
CETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLA    281 - 350
RNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL    351 - 420
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRI    421 - 490
ANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQ    491 - 560
NQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKL    561 - 630
MEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLP    631 - 700
RIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS                             701 - 745
//

Text Mined References (517)

PMID Year Title
26841645 [Morphological characteristics of inflammation in HIV-associated pulmonary tuberculosis with regard to the expression of myeloperoxidase].
26797862 2016 Biomarkers in Obesity: Serum Myeloperoxidase and Traditional Cardiac Risk Parameters.
26714302 2016 Binding of human myeloperoxidase to red blood cells: Molecular targets and biophysical consequences at the plasma membrane level.
26576922 2015 Systemic and coronary levels of CRP, MPO, sCD40L and PlGF in patients with coronary artery disease.
26567811 2015 Active and total myeloperoxidase in coronary artery disease and relation to clinical instability.
26541603 2016 Association of myeloperoxidase levels with cardiometabolic factors and renal function in prepubertal children.
26431910 2015 Gender-specific protective effect of the -463G>A polymorphism of myeloperoxidase gene against the risk of essential hypertension in Russians.
26392121 2015 N-Acetylcysteine attenuates tumor necrosis factor alpha levels in autoimmune inner ear disease patients.
26386352 2015 Uncovering a new role for peroxidase enzymes as drivers of angiogenesis.
26323935 2015 The association between myeloperoxidase 463G>A polymorphisms and risk of lung cancer in East-Asia population.
More...