Property Summary

NCBI Gene PubMed Count 49
Grant Count 26
R01 Count 10
Funding $17,214,245.83
PubMed Score 13.38
PubTator Score 63.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (43)

PMID Text
26885508 Galectin-1 was undetectable in normal and ulcerative colitis colonic epithelium, while galectin-2, galectin-3, and galectin-4 were strongly expressed.
26045830 PPARG rs1152002, AGTR1 rs5186, CXCL16 rs3744700 and LGALS2 rs7291467 polymorphisms may be closely related to the development of coronary heart disease
25953264 Lower LGALS2 gene expression is associated with acute myeloid leukemia.
25884209 Galectin-2 binding to different circulating human monocyte subsets depends on monocyte surface expression levels of CD14. It skews human macrophages to a M1-like proinflammatory phenotype.
25707742 Data suggest that expression of galectin 2 and galectin 2 mRNA is down-regulated in placental extravillous trophoblast and decidua in women with pre-eclampsia as compared to women with normal term pregnancy.
24984218 Gal-1, 2, and 3 levels were high in maintenance hemodialysis patients. Kidney transplantation improved gal-1, 2, and 3 levels.
24384681 The increased circulation of galectins -2, -4 and -8 in cancer patients contributes substantially to the increased circulation of G-CSF, IL-6 and MCP-1 by interaction with the blood vascular endothelium
23581621 Cys57Met (single-site) mutant and its monoPEGylated derivative can markedly reduce binding of galectin-2 to physiological binding sites
22310064 LTA and LGALS2 polymorphisms affect the subclinical phenotype of the coronary artery, which predisposes to the incidence of myocardial infarction.
22015694 low expression of galectin-2 was significantly associated with lymph node metastasis and advanced clinical stage in patients with gastric cancer
More...

AA Sequence

MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQR      1 - 70
EDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE             71 - 132
//

Text Mined References (50)

PMID Year Title
26885508 2016 Immunohistochemical Studies on Galectin Expression in Colectomised Patients with Ulcerative Colitis.
26045830 2015 PPARG, AGTR1, CXCL16 and LGALS2 polymorphisms are correlated with the risk for coronary heart disease.
25953264 2015 Expression profiling of cancer-related galectins in acute myeloid leukemia.
25884209 2015 Galectin-2 induces a proinflammatory, anti-arteriogenic phenotype in monocytes and macrophages.
25707742 2015 Galectin 2 (gal-2) expression is downregulated on protein and mRNA level in placentas of preeclamptic (PE) patients.
25416956 2014 A proteome-scale map of the human interactome network.
24984218 2014 Alternations of galectin levels after renal transplantation.
24384681 2014 Circulating galectins -2, -4 and -8 in cancer patients make important contributions to the increased circulation of several cytokines and chemokines that promote angiogenesis and metastasis.
23581621 2013 Single-site mutational engineering and following monoPEGylation of the human lectin galectin-2: effects on ligand binding, functional aspects, and clearance from serum.
22310064 2012 Polymorphisms of LTA, LGALS2, and PSMA6 genes and coronary atherosclerosis: a pathological study of 1503 consecutive autopsy cases.
More...