Property Summary

NCBI Gene PubMed Count 140
PubMed Score 334.51
PubTator Score 246.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (31)

Disease log2 FC p
Systemic lupus erythematosus 2.100 4.2e-05
active Crohn's disease 1.295 8.0e-03
active ulcerative colitis 1.435 2.6e-02
Astrocytoma, Pilocytic 1.100 8.2e-03
Atopic dermatitis 1.500 3.4e-03
Barrett's esophagus 2.100 4.1e-02
Breast cancer 2.700 8.8e-10
breast carcinoma 1.200 1.2e-02
cutaneous lupus erythematosus 5.100 2.5e-06
cystic fibrosis 2.200 1.1e-03
dermatomyositis 3.200 7.2e-03
esophageal adenocarcinoma 2.400 1.8e-02
glioblastoma multiforme 1.300 1.4e-07
group 3 medulloblastoma -1.200 8.8e-03
interstitial cystitis 1.500 6.9e-04
intraductal papillary-mucinous neoplasm ... 2.300 2.3e-02
invasive ductal carcinoma 1.700 3.2e-03
juvenile dermatomyositis 5.252 1.7e-30
lung adenocarcinoma 1.400 5.8e-04
malignant mesothelioma 2.100 2.8e-06
medulloblastoma, large-cell -2.200 5.2e-05
Multiple myeloma 2.077 8.4e-03
Multiple Sclerosis 2.900 1.7e-02
non primary Sjogren syndrome sicca 1.400 1.0e-02
ovarian cancer 3.300 3.5e-05
pancreatic cancer 1.900 4.1e-05
pancreatic ductal adenocarcinoma liver m... 2.348 4.6e-02
posterior fossa group A ependymoma 1.100 1.9e-02
psoriasis 2.700 1.6e-06
subependymal giant cell astrocytoma 2.821 2.3e-02
tuberculosis 1.500 1.3e-02

 GO Function (1)

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (119)

AA Sequence

MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST      1 - 70
VLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY     71 - 140
GLKPLSTVFMNLRLRGGGTEPGGRS                                                 141 - 165
//

Text Mined References (153)

PMID Year Title