Property Summary

NCBI Gene PubMed Count 126
Grant Count 171
R01 Count 113
Funding $17,133,132.39
PubMed Score 301.77
PubTator Score 246.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P05161 Q5SVA4 Q7Z2G2 Q96GF0
Symbols G1P2
IP17
UCRP
IFI15
IMD38
hUCRP

Gene

PDB

1Z2M   2HJ8   3PHX   3PSE   3R66   3RT3   3SDL  

 GO Function (1)

Gene RIF (109)

PMID Text
26763998 This study shows that interferon-stimulated gene 15 (ISG15) lowers Human respiratory syncytial virus growth through protein ISGylation.
26617815 ISG15 might serve as a novel prognostic biomarker in drinkers with esophageal squamous cell cancer
26563749 ISG15 is elevated in viremic HIV-1 patients and is associated with high TRAIL and IDO levels.
26560068 Data show the induction of signal transducer and activator of transcription (STAT)1 and IFN-stimulated gene 15 protein (ISG15) in Rickettsia conorii-infected human umbilical vein endothelial cells (HUVECs).
26361997 The inhibitory effect of ISG15 on HCV RNA replication does not require its conjugation to substrates by HERC5.
26259872 These data reveal a previously uncharacterized ISG15-dependent restriction of Listeria infection, reinforcing the view that ISG15 is a key component of the innate immune response.
26226047 Cellular ubiquitin is a substrate of ISG15 and Lys 29 on ubiquitin is the major ISG15 acceptor site.
26116899 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
26036210 Microparticles released from Mycobacterium tuberculosis-infected human macrophages contain increased levels of the type I interferon inducible protein ISG15.
25906440 that ISGylation of BECN1 at Lys117, as well as Lys263, Lys265, and Lys266 serve an important role in negative regulation of intracellular processes including autophagy
More...

AA Sequence

MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST      1 - 70
VLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY     71 - 140
GLKPLSTVFMNLRLRGGGTEPGGRS                                                 141 - 165
//

Text Mined References (139)

PMID Year Title
26763998 2016 ISG15 Is Upregulated in Respiratory Syncytial Virus Infection and Reduces Virus Growth through Protein ISGylation.
26617815 2015 Prognostic value of ISG15 mRNA level in drinkers with esophageal squamous cell cancers.
26563749 2016 ISG15 expression correlates with HIV-1 viral load and with factors regulating T cell response.
26560068 2016 Endothelial Cell Proteomic Response to Rickettsia conorii Infection Reveals Activation of the Janus Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT)-Inferferon Stimulated Gene (ISG)15 Pathway and Reprogramming Plasma Membrane Integrin/Cadherin Signaling.
26361997 2015 Inhibition of hepatitis C virus RNA replication by ISG15 does not require its conjugation to protein substrates by the HERC5 E3 ligase.
26259872 2015 ISG15 counteracts Listeria monocytogenes infection.
26226047 2015 Identification and characterization of a novel ISG15-ubiquitin mixed chain and its role in regulating protein homeostasis.
26036210 2015 Microparticles released from Mycobacterium tuberculosis-infected human macrophages contain increased levels of the type I interferon inducible proteins including ISG15.
25906440 2015 Modification of BECN1 by ISG15 plays a crucial role in autophagy regulation by type I IFN/interferon.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
More...