Property Summary

NCBI Gene PubMed Count 106
PubMed Score 304.11
PubTator Score 377.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 5.787 2.9

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 2.599 7.2e-03
active ulcerative colitis 2.861 2.1e-02
adult high grade glioma 2.400 4.7e-05
aldosterone-producing adenoma -2.252 1.4e-02
astrocytoma 1.200 3.4e-05
Astrocytoma, Pilocytic 5.100 2.0e-15
Barrett's esophagus 1.200 4.3e-02
Breast cancer -1.400 7.8e-27
cystic fibrosis 1.300 1.6e-02
ependymoma 4.400 3.9e-13
glioblastoma 2.600 7.6e-05
group 3 medulloblastoma 1.600 6.9e-04
interstitial cystitis 1.100 3.7e-03
lung cancer -1.200 1.8e-02
lung carcinoma -2.000 2.6e-18
malignant mesothelioma -7.000 3.3e-10
nephrosclerosis -1.234 1.7e-02
non-small cell lung cancer -1.030 1.3e-05
ovarian cancer -4.600 1.2e-15
pancreatic ductal adenocarcinoma liver m... -2.682 4.2e-03
periodontitis 1.100 3.5e-26
pituitary cancer -1.600 5.3e-06
subependymal giant cell astrocytoma 3.460 6.2e-03
urothelial carcinoma -3.300 4.9e-06

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (76)

AA Sequence

MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKN      1 - 70
GTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFI     71 - 140
CKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFA    141 - 210
DVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNG    211 - 280
EVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGD    281 - 350
LPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHEN    351 - 420
YNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVK    421 - 490
LISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT    491 - 560
KVANYFDWISYHVGRPFISQYNV                                                   561 - 583
//

Text Mined References (111)

PMID Year Title