Property Summary

NCBI Gene PubMed Count 175
PubMed Score 1285.93
PubTator Score 984.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
lung carcinoma 2843 9.7e-40
juvenile dermatomyositis 1187 6.1e-16
non-small cell lung cancer 2890 3.9e-14
Astrocytoma, Pilocytic 3081 5.1e-12
lung adenocarcinoma 2716 1.7e-11
ovarian cancer 8520 9.6e-11
malignant mesothelioma 3232 3.5e-10
pituitary cancer 1972 1.2e-08
breast carcinoma 1638 1.5e-08
ependymoma 4679 4.7e-08
Duchenne muscular dystrophy 601 1.1e-07
limb girdle muscular dystrophy 2A 213 2.0e-05
ulcerative colitis 1819 2.1e-05
adrenocortical carcinoma 1428 6.4e-05
cystic fibrosis 1696 7.9e-05
psoriasis 6694 1.1e-04
fibroadenoma 559 2.1e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 2.1e-04
acute quadriplegic myopathy 1158 2.3e-04
ductal carcinoma in situ 1745 3.8e-04
invasive ductal carcinoma 2951 7.0e-04
atypical teratoid / rhabdoid tumor 5112 1.0e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 2.1e-03
adult high grade glioma 3801 3.1e-03
tuberculosis 2010 3.7e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 6.1e-03
lung cancer 4740 7.4e-03
Systemic lupus erythematosus 194 8.8e-03
sonic hedgehog group medulloblastoma 467 1.0e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 1.0e-02
glioblastoma 5792 1.1e-02
subependymal giant cell astrocytoma 2287 1.2e-02
gastric carcinoma 807 1.3e-02
Breast cancer 3578 1.7e-02
chronic kidney disease 90 1.8e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 2.0e-02
dermatomyositis 966 2.1e-02
primitive neuroectodermal tumor 3035 2.4e-02
sarcoidosis 370 2.8e-02
Multiple Sclerosis 540 3.9e-02
Polycystic ovary syndrome 360 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hereditary angioedema 3 0.0 5.0
Disease Target Count
Angioedema, Hereditary, Type 1 1

Expression

  Differential Expression (41)

Disease log2 FC p
acute quadriplegic myopathy 1.375 2.3e-04
adrenocortical carcinoma -2.357 6.4e-05
adult high grade glioma 1.600 3.1e-03
Astrocytoma, Pilocytic 2.800 5.1e-12
atypical teratoid / rhabdoid tumor 1.500 1.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.233 1.0e-02
Breast cancer -1.400 1.7e-02
breast carcinoma -1.100 1.5e-08
chronic kidney disease 1.300 1.8e-02
cystic fibrosis 2.500 7.9e-05
dermatomyositis 1.200 2.1e-02
Duchenne muscular dystrophy 1.679 1.1e-07
ductal carcinoma in situ -1.500 3.8e-04
ependymoma 2.200 4.7e-08
fibroadenoma -1.300 2.1e-04
gastric carcinoma 1.500 1.3e-02
glioblastoma 1.700 1.1e-02
intraductal papillary-mucinous adenoma (... -2.600 2.1e-03
intraductal papillary-mucinous carcinoma... -2.700 6.1e-03
intraductal papillary-mucinous neoplasm ... -3.200 2.1e-04
invasive ductal carcinoma -1.700 7.0e-04
juvenile dermatomyositis 2.189 6.1e-16
limb girdle muscular dystrophy 2A 1.305 2.0e-05
lung adenocarcinoma -1.800 1.7e-11
lung cancer -1.300 7.4e-03
lung carcinoma -3.300 9.7e-40
malignant mesothelioma -6.300 3.5e-10
Multiple Sclerosis 1.600 3.9e-02
non-small cell lung cancer -1.391 3.9e-14
ovarian cancer -3.700 9.6e-11
pancreatic ductal adenocarcinoma liver m... -2.161 2.0e-02
pituitary cancer -2.700 1.2e-08
Polycystic ovary syndrome 1.600 4.6e-02
primitive neuroectodermal tumor 1.200 2.4e-02
psoriasis -1.100 1.1e-04
sarcoidosis 1.100 2.8e-02
sonic hedgehog group medulloblastoma 1.100 1.0e-02
subependymal giant cell astrocytoma 1.812 1.2e-02
Systemic lupus erythematosus 1.400 8.8e-03
tuberculosis 2.500 3.7e-03
ulcerative colitis 2.300 2.1e-05

 CSPA Cell Line (1)

Protein-protein Interaction (4)

Gene RIF (118)

AA Sequence

MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNS      1 - 70
TTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTGSFCPGPVTLCSDLESHSTEA     71 - 140
VLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQAL    141 - 210
KGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDS    211 - 280
LPSDTRLVLLNAIYLSAKWKTTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLS    281 - 350
HNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFD    351 - 420
FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFVLWDQQHKFPV    421 - 490
FMGRVYDPRA                                                                491 - 500
//

Text Mined References (186)

PMID Year Title