Property Summary

NCBI Gene PubMed Count 92
PubMed Score 435.42
PubTator Score 280.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.8e-04
Atopic dermatitis -1.100 4.3e-06
cutaneous lupus erythematosus -1.200 1.6e-02
ependymoma 1.900 1.3e-04
fibroadenoma 2.900 7.2e-05
intraductal papillary-mucinous carcinoma... -2.200 5.8e-05
intraductal papillary-mucinous neoplasm ... -2.000 2.9e-03
pancreatic ductal adenocarcinoma liver m... -2.569 1.3e-02
psoriasis -1.600 8.7e-37

Gene RIF (30)

AA Sequence

MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPV      1 - 70
SISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVD     71 - 140
LQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWE    141 - 210
TSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVEN    211 - 280
GLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHK    281 - 350
AVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP                  351 - 406
//

Text Mined References (100)

PMID Year Title