Property Summary

NCBI Gene PubMed Count 90
Grant Count 25
R01 Count 14
Funding $3,179,928.4
PubMed Score 427.01
PubTator Score 280.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
25887633 host protein C inhibitor expressed in mouse has a role in inhibiting tumor growth, but promotes tumor metastasis, which is closely correlated with hypercoagulability
24928035 These results suggest that HIV resistance in some exposed patients is the result of a balance between downregulation of serine proteinases and upregulation of their inhibitors.
24388360 These findings highlight an important role of SERPINA5 in the regulation of migratory and metastatic potentials of HCC and suggest a potential application of SERPINA5 in cancer treatment.
24222120 Decreased SERPINA5 expression due to DNA promoter methylation is associated with papillary thyroid carcinoma.
23670045 A novel protein C inhibitor gene mutation in pediatric stroke patients after bone marrow transplantation.
23520464 the SERPINA5 gene, which codes for the protein C inhibitor involved in many biological processes including inflammation, may be a new susceptibility locus for PTC.
22206708 One of the monomers, 52-kDa PCI, formed a stable complex with activated protein C, urokinase, plasma and tissue kallikrein, but the dimer species and 48-kDa PCI were inactive.
22205989 the effects of N-glycans and the NH-terminus on a PCI function
21102419 SerpinA5 expression is significantly reduced in advanced-stage serous borderline tumors and serous carcinomas.
21056543 This study was undertaken to further understand the structural micro-heterogeneity of PCI. Individuals of two different ethnicities possess a similar PCI pattern, verifying that the micro-heterogeneity is conserved among humans.
More...

AA Sequence

MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPV      1 - 70
SISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVD     71 - 140
LQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWE    141 - 210
TSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVEN    211 - 280
GLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHK    281 - 350
AVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP                  351 - 406
//

Text Mined References (98)

PMID Year Title
25887633 2015 Host protein C inhibitor inhibits tumor growth, but promotes tumor metastasis, which is closely correlated with hypercoagulability.
24928035 2014 Increased Serpin A5 levels in the cervicovaginal fluid of HIV-1 exposed seronegatives suggest that a subtle balance between serine proteases and their inhibitors may determine susceptibility to HIV-1 infection.
24388360 2014 SERPINA5 inhibits tumor cell migration by modulating the fibronectin-integrin ?1 signaling pathway in hepatocellular carcinoma.
24222120 2013 DNA methylation of MAPK signal-inhibiting genes in papillary thyroid carcinoma.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23670045 2013 A novel protein C inhibitor gene mutation in pediatric stroke patients after bone marrow transplantation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23520464 2013 Common single nucleotide polymorphisms in genes related to immune function and risk of papillary thyroid cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22721676 Assessment of gene expression profiles in peripheral occlusive arterial disease.
More...