Property Summary

NCBI Gene PubMed Count 52
PubMed Score 91.59
PubTator Score 728.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 2.347 7.2e-10
Breast cancer 2.900 2.4e-02
breast carcinoma 1.200 7.7e-03
dermatomyositis 1.800 4.6e-04
Duchenne muscular dystrophy 1.148 1.5e-08
Multiple myeloma 2.003 1.1e-04
ovarian cancer 1.600 4.6e-03
Waldenstrons macroglobulinemia 1.900 1.7e-03

 MGI Phenotype (1)

Gene RIF (23)

AA Sequence

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF      1 - 70
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTR     71 - 140
LAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI    141 - 210
VISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLR    211 - 280
GMGGAFVLVLYDEIKKYT                                                        281 - 298
//

Text Mined References (61)

PMID Year Title