Property Summary

NCBI Gene PubMed Count 50
Grant Count 19
R01 Count 14
Funding $1,684,410.23
PubMed Score 87.51
PubTator Score 728.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.900 0.002
Multiple myeloma 2.003 0.000
Duchenne muscular dystrophy 1.148 0.000
acute quadriplegic myopathy 2.347 0.000
breast carcinoma 1.200 0.008
Breast cancer 2.900 0.024
ovarian cancer 1.600 0.005
dermatomyositis 1.800 0.000

Gene RIF (24)

PMID Text
27012708 ANT2 shRNA downregulates miR-19a and miR-96 through the PI3K/Akt pathway and suppresses tumor growth in hepatocellular carcinoma cells.
26842067 cancer cells require both hANT2 and hANT3, depending on their proliferation status: hANT2 when proliferation rates are high, and hANT3 when proliferation slows.
25982278 IFNgamma induces oxidative stress, DNA damage and tumor cell senescence via TGFbeta/SMAD signaling-dependent induction of Nox4 and suppression of ANT2
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
24296486 Sirt4 regulates ATP levels via ANT2 and a feedback loop involving AMPK.
23874603 Tandem affinity purification and mass spectrometry analysis identify solute carrier family 25 member 5 (SLC25A5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23783460 SLC25A5 is involved in memory formation or establishment, which could add mitochondrial processes to the wide array of pathways that regulate normal cognitive functions.
23431365 Apigenin upregulates DR5 and enhances TRAIL induced apoptosis by binding and inhibiting ANT2.
23306701 miR-636 might function as a tumor suppressor miRNA affecting hepatocellular carcinoma (HCC) tumorigenesis via downregulation of Ras, and that ANT2 suppression by shRNA could exert an anticancer effect by restoring miR-636 expression in HCC.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
More...

AA Sequence

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF      1 - 70
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTR     71 - 140
LAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI    141 - 210
VISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLR    211 - 280
GMGGAFVLVLYDEIKKYT                                                        281 - 298
//

Text Mined References (59)

PMID Year Title
27012708 2016 ANT2 shRNA downregulates miR-19a and miR-96 through the PI3K/Akt pathway and suppresses tumor growth in hepatocellular carcinoma cells.
26842067 2016 Changes in the expression of the human adenine nucleotide translocase isoforms condition cellular metabolic/proliferative status.
25982278 2016 IFN? induces oxidative stress, DNA damage and tumor cell senescence via TGF?/SMAD signaling-dependent induction of Nox4 and suppression of ANT2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24296486 2013 SIRT4 regulates ATP homeostasis and mediates a retrograde signaling via AMPK.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
More...