Property Summary

NCBI Gene PubMed Count 134
Grant Count 82
R01 Count 47
Funding $9,071,356.81
PubMed Score 94.07
PubTator Score 175.33

Knowledge Summary

Patent (158,575)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -1.700 0.000
glioblastoma multiforme -1.800 0.000
oligodendroglioma -1.800 0.000
posterior fossa group A ependymoma -1.800 0.000
group 3 medulloblastoma -2.200 0.001
atypical teratoid/rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.200 0.004
primitive neuroectodermal tumor -1.500 0.001
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.700 0.000
psoriasis -1.400 0.001

Synonym

Accession P05129 B7Z8Q0 PKC-gamma
Symbols PKCC
PKCG
SCA14
PKC-gamma

Gene

PDB

2E73   2UZP  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (86)

PMID Text
26921055 The gene-environment combination of PRKCG rs3745406 C allele, BDNF rs6265 G allele and high level of negative life events was significantly associated with major depressive disorder.
26112605 Data suggest that PRKCG (protein kinase C gamma) phosphorylates TA isoforms of p63 (tumor protein p63) at Thr157 to stabilize them and promote cell apoptosis in tumor cells.
25663494 The results showed that carrier of rs454006*C allele and rs3745406*C might elevate the risk of osteosarcoma
25252845 The rs454006 polymorphism of the PRKCG gene correlated to osteosarcoma susceptibility and might increase the risk of osteosarcoma.
25217572 PKCgamma,mutated in the neurodegenerative disease spinocerebellar ataxia type 14 is a novel amyloidogenic protein.
24937631 findings provide evidence for both an increased PKCgamma activity in Purkinje cells in vivo and for pathological changes typical for cerebellar disease thus linking increased and dysregulated activity of PKCgamma to development of cerebellar disease
24134140 we show that the mutation V138E of the protein kinase C gamma (PKCgamma) C1B domain, which is implicated in spinocerebellar ataxia type 14, exhibits a partially unfolded C-terminus
24117238 PKCgamma plays a critical role in cancer cells, and simultaneous inhibition of PKCgamma and Hsp90alpha synergistically prevents cell migration and promotes apoptosis in cancer cells.
24021284 Spinocerebellar ataxia type 14 mutant PKC-gamma upregulates Hsp70. Hsp70 has a role in degrading mutant PKC-gamma.
22675081 Exome sequencing of large, 5-generational British kindred finds a novel p.Arg26Gly mutation in the PRKCG gene causing familial spinocerebellar ataxia 14.
More...

AA Sequence

MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCS      1 - 70
FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHR     71 - 140
RCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQ    141 - 210
KTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQ    211 - 280
EEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISD    281 - 350
FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL    351 - 420
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDA    421 - 490
EGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDE    491 - 560
EELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPP    561 - 630
FRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM       631 - 697
//

Text Mined References (138)

PMID Year Title
26921055 2016 The interaction of combined effects of the BDNF and PRKCG genes and negative life events in major depressive disorder.
26112605 2015 PKC? stabilizes TAp63 to promote cell apoptosis.
25663494 2015 Genetic variations in the PRKCG gene and osteosarcoma risk in a Chinese population: a case-control study.
25252845 2014 Single-nucleotide polymorphisms of the PRKCG gene and osteosarcoma susceptibility.
25217572 2015 Identification and characterization of PKC?, a kinase associated with SCA14, as an amyloidogenic protein.
24937631 2014 Increased protein kinase C gamma activity induces Purkinje cell pathology in a mouse model of spinocerebellar ataxia 14.
24134140 2014 SCA14 mutation V138E leads to partly unfolded PKC? associated with an exposed C-terminus, altered kinetics, phosphorylation and enhanced insolubilization.
24117238 2014 The regulatory mechanism of a client kinase controlling its own release from Hsp90 chaperone machinery through phosphorylation.
24021284 2013 Mutant ?PKC that causes spinocerebellar ataxia type 14 upregulates Hsp70, which protects cells from the mutant's cytotoxicity.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
More...