Property Summary

Ligand Count 39
NCBI Gene PubMed Count 135
PubMed Score 103.89
PubTator Score 175.33

Knowledge Summary

Patent (158,575)

TINX Plot

  Disease (8)

Disease Target Count
Actinic keratosis 21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 4.31 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 2.5e-05
astrocytoma -1.700 9.9e-29
Astrocytoma, Pilocytic -1.100 7.4e-06
atypical teratoid / rhabdoid tumor -1.100 9.5e-05
ependymoma -1.400 3.1e-06
glioblastoma -1.600 8.4e-09
group 3 medulloblastoma -2.200 8.3e-04
medulloblastoma, large-cell -1.100 4.5e-04
oligodendroglioma -1.800 8.5e-24
primitive neuroectodermal tumor -1.500 8.6e-04
psoriasis -1.400 7.9e-04

Gene RIF (86)

AA Sequence

MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCS      1 - 70
FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHR     71 - 140
RCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQ    141 - 210
KTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQ    211 - 280
EEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISD    281 - 350
FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL    351 - 420
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDA    421 - 490
EGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDE    491 - 560
EELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPP    561 - 630
FRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM       631 - 697
//

Text Mined References (139)

PMID Year Title