Property Summary

NCBI Gene PubMed Count 1,199
Grant Count 1,084
R01 Count 600
Funding $160,806,486.62
PubMed Score 5666.43
PubTator Score 4971.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (72)

Disease Z-score Confidence
Coronary artery disease 240 6.023 3.0
diabetes mellitus 1,663 5.688 2.8
Obesity 616 5.63 2.8
Atherosclerosis 275 5.605 2.8
Hypertension 287 5.435 2.7
Thrombophilia 36 5.425 2.7
Metabolic syndrome X 155 5.301 2.7
Cancer 2,346 5.136 2.6
Kidney disease 396 5.107 2.6
Cerebrovascular disease 231 5.046 2.5
Lipid metabolism disorder 102 4.407 2.2
Hyperinsulinism 63 4.301 2.2
Heart disease 279 4.131 2.1
Hyperglycemia 120 3.948 2.0
Polycystic Ovary Syndrome 332 3.925 2.0
Lung disease 132 3.917 2.0
Peripheral vascular disease 90 3.873 1.9
Pulmonary Embolism 45 3.81 1.9
Ureteral disease 23 3.676 1.8
Osteonecrosis 25 3.56 1.8
Hyperhomocysteinemia 34 3.551 1.8
Liver disease 219 3.328 1.7
Venous insufficiency 6 3.192 1.6
Hypersensitivity reaction type II diseas... 235  3.187 1.6
Diabetic Retinopathy 53 3.073 1.5
Fatty liver disease 84 3.071 1.5
Atopic dermatitis 944
Autistic Disorder 320
Behcet Syndrome 23
Cholestasis 93
Diabetes Mellitus, Experimental 106
Diabetic Nephropathy 37
Fatty Liver 48
Focal glomerulosclerosis 22
Heart failure 80
Hypertensive disease 193
IGA Glomerulonephritis 454
Kidney Failure, Chronic 45
Liver neoplasms 109
Nephrotic Syndrome 48
Plasminogen Activator Inhibitor-1 Defici... 1 
Prostatic Neoplasms 471
Respiratory Hypersensitivity 18
Stomach Neoplasms 282
Thrombosis 42
atypical teratoid / rhabdoid tumor 4,369
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nervous system disorder 53
non diabetic and post-ischemic heart fai... 200 
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
pre-eclampsia 67
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087

Expression

Synonym

Accession P05121 B7Z4S0 F8WD53 PAI
Symbols PAI
PAI1
PAI-1
PLANH1

Gene

PDB

3PB1   5BRR   1A7C   1B3K   1C5G   1DB2   1DVM   1DVN   1LJ5   1OC0   3CVM   3EOX   3Q02   3Q03   3R4L   3UT3   4AQH   4G8O   4G8R   4IC0   9PAI  

Gene RIF (1273)

PMID Text
27022914 high levels of PAI-1 are detected when D allele is present, whereas greater interdialytic gain is associated with the presence of I allele.
26903689 Results showed an increased expression level of PAI-1 suggesting it as a potential marker of placental insufficiency and identify its close association with pathological hypoxia and angiogenesis in a subset of growth restricted pregnancies.
26733586 The sequestration of unfolded protein response activators GRP78 and GRP94 in neuroserpin inclusions might explain the limited unfolded protein response responses despite the accumulation of neuroserpin in the endoplasmic reticulum
26714278 Plasminogen Activator Inhibitor-1 Controls Vascular Integrity by Regulating VE-Cadherin Trafficking
26676222 Cancer cells adhered to basal membrane secrete abundant PAI-1.
26658948 PAI-1 polymorphism did not show any association with diabetic retinopathy in the current Pakistani cohort.
26643086 These findings strongly support the use of uPA/PAI-1 together with clinic-pathological parameters as an evidence-based, clinically relevant and inexpensive decision tool in the routine of a breast center.
26559247 In conclusion, -675 4G/5G polymorphism in the SERPINE1 gene may not be associated with the risk of sepsis.
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26540464 Using single fluorescence probes along the reactive center loop the study provides new insights by characterizing multiple steps in the latency transition of PAI-1.
More...

AA Sequence

MQMSPALTCLVLGLALVFGEGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQ      1 - 70
LTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLF     71 - 140
RSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRR    141 - 210
LFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQ    211 - 280
LISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIE    281 - 350
VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP                      351 - 402
//

Text Mined References (1201)

PMID Year Title
27022914 2016 Influence of ACE I/D Polymorphism on Circulating Levels of Plasminogen Activator Inhibitor 1, D-Dimer, Ultrasensitive C-Reactive Protein and Transforming Growth Factor ?1 in Patients Undergoing Hemodialysis.
26903689 2016 Increased Umbilical Cord PAI-1 Levels in Placental Insufficiency Are Associated with Fetal Hypoxia and Angiogenesis.
26733586 2016 Limited Unfolded Protein Response and Inflammation in Neuroserpinopathy.
26714278 2015 Plasminogen Activator Inhibitor-1 Controls Vascular Integrity by Regulating VE-Cadherin Trafficking.
26676222 2016 Decreased expression of the plasminogen activator inhibitor type 1 is involved in degradation of extracellular matrix surrounding cervical cancer stem cells.
26658948 2015 Role of ACE and PAI-1 Polymorphisms in the Development and Progression of Diabetic Retinopathy.
26643086 2016 Impact of guideline-based use of uPA/PAI-1 on patient outcome in intermediate-risk early breast cancer.
26559247 2015 No Association of SERPINE1 -675 Polymorphism With Sepsis Susceptibility: A Meta-Analysis.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26540464 2016 Single fluorescence probes along the reactive center loop reveal site-specific changes during the latency transition of PAI-1.
More...