Property Summary

Ligand Count 69
NCBI Gene PubMed Count 1,255
PubMed Score 5657.16
PubTator Score 4971.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 2.400 1.4e-04
Astrocytoma, Pilocytic 2.100 4.2e-04
Atopic dermatitis 1.100 1.3e-02
atypical teratoid / rhabdoid tumor 1.300 1.2e-02
cutaneous lupus erythematosus 1.200 4.3e-02
cystic fibrosis 1.600 1.9e-04
ependymoma 2.000 5.1e-04
esophageal adenocarcinoma 1.100 2.5e-02
gastric carcinoma 2.100 2.7e-02
glioblastoma 2.400 8.6e-06
interstitial cystitis 3.000 1.9e-04
intraductal papillary-mucinous adenoma (... -2.000 3.5e-04
intraductal papillary-mucinous carcinoma... -1.800 9.3e-04
intraductal papillary-mucinous neoplasm ... -1.700 1.2e-02
invasive ductal carcinoma 1.400 7.8e-03
lung cancer -2.000 1.5e-04
lung carcinoma -2.200 3.4e-08
malignant mesothelioma -2.400 1.7e-08
non diabetic and post-ischemic heart fai... -3.100 7.4e-03
osteosarcoma 1.473 1.7e-04
ovarian cancer 2.100 8.0e-04
pancreatic cancer 2.800 2.3e-03
primary pancreatic ductal adenocarcinoma 2.054 6.7e-03
psoriasis -1.100 2.6e-03
tuberculosis -3.100 1.4e-08
ulcerative colitis 2.000 2.4e-03

Protein-protein Interaction (1)

Gene RIF (1325)

AA Sequence

MQMSPALTCLVLGLALVFGEGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQ      1 - 70
LTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLF     71 - 140
RSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRR    141 - 210
LFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQ    211 - 280
LISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIE    281 - 350
VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP                      351 - 402
//

Text Mined References (1256)

PMID Year Title