Property Summary

NCBI Gene PubMed Count 90
Grant Count 70
R01 Count 36
Funding $6,817,068.16
PubMed Score 491.86
PubTator Score 388.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer -1.200 0.028
malignant mesothelioma -4.000 0.000
esophageal adenocarcinoma -3.900 0.023
uncontrolled asthma 2.300 0.005
psoriasis 1.300 0.005
osteosarcoma -1.366 0.006
cystic fibrosis 5.361 0.000
Atopic dermatitis -1.400 0.004
tuberculosis -5.600 0.000
non-small cell lung cancer 1.979 0.000
pancreatic cancer 2.400 0.001
interstitial cystitis 1.800 0.010
nasopharyngeal carcinoma -3.500 0.000
spina bifida -1.375 0.044

Synonym

Accession P05120 Q96E96 PAI-2
Symbols PAI
PAI2
PAI-2
PLANH2
HsT1201

Gene

PDB

1BY7   1JRR   2ARQ   2ARR  

Gene RIF (67)

PMID Text
26573152 The variant of PAI-2 gene was associated with coronary artery disease and recurrent coronary event risk in Chinese Han population, in Xinjiang.
26083412 SerpinB2 plays an important role in proteostas
25775950 a total of 500 ESCC cases and 500 matched controls in a Southwest China population were evaluated for six SNPs in the exons of three Serpin genes (SerpinB5, SerpinB2, and SerpinE1).
25704756 Soluble guanylate cyclase activators might alleviate or reverse vascular remodeling in pulmonary hypertension through the up-regulation of PAI-2.
25444509 Polymorphisms in this fibrinolytic system gene are associated with recurrent spontaneous abortion in Sinhalese women, probably through impaired implantation.
25046655 PAI-2 was up-regulated in tensioned keloid fibroblasts and normal fibroblasts, but more so in keloid cells. Knockdown of PAI2 reduced cell proliferation in fibroblasts under tension.
24162774 HIV-1 gp120 upregulates the expression of serpin peptidase inhibitor, clade B, member 2 (SERPINB2) in human B cells
23898208 HIV-1 gp120 upregulates the expression of serpin peptidase inhibitor, clade B, member 2 (SERPINB2) in human B cells
23897640 We found no association between allele frequency and risk of multiples sclerosis for any single nucleotide polymorphism investigated for serpinb2
23874812 Plasminogen activator inhibitor-2 polymorphism associates with recurrent coronary event risk in patients with high HDL and C-reactive protein levels.
More...

AA Sequence

MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP      1 - 70
MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE     71 - 140
YIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT    141 - 210
PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE    211 - 280
LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF    281 - 350
LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP         351 - 415
//

Text Mined References (92)

PMID Year Title
26573152 2015 Variant of PAI-2 gene is associated with coronary artery disease and recurrent coronary event risk in Chinese Han population.
26083412 2015 SerpinB2 (PAI-2) Modulates Proteostasis via Binding Misfolded Proteins and Promotion of Cytoprotective Inclusion Formation.
25775950 2015 Association between SNPs in Serpin gene family and risk of esophageal squamous cell carcinoma.
25704756 2015 The sGC activator inhibits the proliferation and migration, promotes the apoptosis of human pulmonary arterial smooth muscle cells via the up regulation of plasminogen activator inhibitor-2.
25444509 2014 Polymorphisms in the fibrinolytic pathway genes and the risk of recurrent spontaneous abortion.
25046655 Skin equivalent tensional force alters keloid fibroblast behavior and phenotype.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23897640 2014 Common genetic variants in the plasminogen activation pathway are not associated with multiple sclerosis.
23874812 2013 Plasminogen activator inhibitor-2 polymorphism associates with recurrent coronary event risk in patients with high HDL and C-reactive protein levels.
23661500 2014 SERPINB2 down-regulation contributes to chemoresistance in head and neck cancer.
More...