Property Summary

NCBI Gene PubMed Count 93
PubMed Score 467.44
PubTator Score 388.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis -1.400 4.1e-03
cystic fibrosis 5.361 1.8e-08
esophageal adenocarcinoma -3.900 2.3e-02
gastric cancer -1.200 2.8e-02
interstitial cystitis 1.800 9.8e-03
malignant mesothelioma -4.000 1.1e-08
nasopharyngeal carcinoma -3.500 1.9e-09
non-small cell lung cancer 1.979 6.4e-05
osteosarcoma -1.366 5.8e-03
pancreatic cancer 2.400 6.6e-04
psoriasis 1.300 5.0e-03
spina bifida -1.375 4.4e-02
tuberculosis -5.600 1.6e-05
uncontrolled asthma 2.300 5.4e-03

 CSPA Cell Line (1)

Gene RIF (70)

AA Sequence

MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP      1 - 70
MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE     71 - 140
YIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT    141 - 210
PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE    211 - 280
LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF    281 - 350
LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP         351 - 415
//

Text Mined References (95)

PMID Year Title