Tbio | Plasminogen activator inhibitor 2 |
Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
Comments
Disease | Target Count |
---|---|
Mammary Neoplasms | 410 |
Non-alcoholic Fatty Liver Disease | 40 |
Peripheral Neuropathy | 303 |
Stomach Neoplasms | 282 |
Disease | Target Count | P-value |
---|---|---|
nasopharyngeal carcinoma | 1056 | 1.88413284033238E-9 |
malignant mesothelioma | 3163 | 1.10143571462158E-8 |
cystic fibrosis | 1670 | 1.7658362300218E-8 |
tuberculosis | 1563 | 1.58407754541145E-5 |
non-small cell lung cancer | 2798 | 6.38954129773311E-5 |
pancreatic cancer | 2300 | 6.63738537935556E-4 |
Atopic dermatitis | 944 | 0.00405353628896002 |
psoriasis | 6685 | 0.00498954532461049 |
uncontrolled asthma | 67 | 0.00542556388298948 |
osteosarcoma | 7933 | 0.00575674731883553 |
interstitial cystitis | 2299 | 0.0098221577762477 |
esophageal adenocarcinoma | 737 | 0.0234033180629823 |
gastric cancer | 436 | 0.0275728253439966 |
spina bifida | 1064 | 0.0443682040447914 |
Disease | log2 FC | p |
---|---|---|
gastric cancer | -1.200 | 0.028 |
malignant mesothelioma | -4.000 | 0.000 |
esophageal adenocarcinoma | -3.900 | 0.023 |
uncontrolled asthma | 2.300 | 0.005 |
psoriasis | 1.300 | 0.005 |
osteosarcoma | -1.366 | 0.006 |
cystic fibrosis | 5.361 | 0.000 |
Atopic dermatitis | -1.400 | 0.004 |
tuberculosis | -5.600 | 0.000 |
non-small cell lung cancer | 1.979 | 0.000 |
pancreatic cancer | 2.400 | 0.001 |
interstitial cystitis | 1.800 | 0.010 |
nasopharyngeal carcinoma | -3.500 | 0.000 |
spina bifida | -1.375 | 0.044 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA Inparanoid |
Cow | OMA EggNOG |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA Inparanoid |
PMID | Text |
---|---|
26573152 | The variant of PAI-2 gene was associated with coronary artery disease and recurrent coronary event risk in Chinese Han population, in Xinjiang. |
26083412 | SerpinB2 plays an important role in proteostas |
25775950 | a total of 500 ESCC cases and 500 matched controls in a Southwest China population were evaluated for six SNPs in the exons of three Serpin genes (SerpinB5, SerpinB2, and SerpinE1). |
25704756 | Soluble guanylate cyclase activators might alleviate or reverse vascular remodeling in pulmonary hypertension through the up-regulation of PAI-2. |
25444509 | Polymorphisms in this fibrinolytic system gene are associated with recurrent spontaneous abortion in Sinhalese women, probably through impaired implantation. |
25046655 | PAI-2 was up-regulated in tensioned keloid fibroblasts and normal fibroblasts, but more so in keloid cells. Knockdown of PAI2 reduced cell proliferation in fibroblasts under tension. |
24162774 | HIV-1 gp120 upregulates the expression of serpin peptidase inhibitor, clade B, member 2 (SERPINB2) in human B cells |
23898208 | HIV-1 gp120 upregulates the expression of serpin peptidase inhibitor, clade B, member 2 (SERPINB2) in human B cells |
23897640 | We found no association between allele frequency and risk of multiples sclerosis for any single nucleotide polymorphism investigated for serpinb2 |
23874812 | Plasminogen activator inhibitor-2 polymorphism associates with recurrent coronary event risk in patients with high HDL and C-reactive protein levels. |
More... |
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP 1 - 70 MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE 71 - 140 YIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT 141 - 210 PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE 211 - 280 LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF 281 - 350 LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 351 - 415 //
PMID | Year | Title |
---|---|---|
26573152 | 2015 | Variant of PAI-2 gene is associated with coronary artery disease and recurrent coronary event risk in Chinese Han population. |
26083412 | 2015 | SerpinB2 (PAI-2) Modulates Proteostasis via Binding Misfolded Proteins and Promotion of Cytoprotective Inclusion Formation. |
25775950 | 2015 | Association between SNPs in Serpin gene family and risk of esophageal squamous cell carcinoma. |
25704756 | 2015 | The sGC activator inhibits the proliferation and migration, promotes the apoptosis of human pulmonary arterial smooth muscle cells via the up regulation of plasminogen activator inhibitor-2. |
25444509 | 2014 | Polymorphisms in the fibrinolytic pathway genes and the risk of recurrent spontaneous abortion. |
25046655 | Skin equivalent tensional force alters keloid fibroblast behavior and phenotype. | |
24172014 | 2013 | Update of the human and mouse SERPIN gene superfamily. |
23897640 | 2014 | Common genetic variants in the plasminogen activation pathway are not associated with multiple sclerosis. |
23874812 | 2013 | Plasminogen activator inhibitor-2 polymorphism associates with recurrent coronary event risk in patients with high HDL and C-reactive protein levels. |
23661500 | 2014 | SERPINB2 down-regulation contributes to chemoresistance in head and neck cancer. |
More... |