Property Summary

NCBI Gene PubMed Count 33
Grant Count 35
R01 Count 7
Funding $4,804,290.09
PubMed Score 192.29
PubTator Score 109.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (14)

PMID Text
27100087 RNA-seq evidence of biallelic expression of HMGN1 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of HMGN1 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
26113410 HMGN1 can serve as a useful clinical parameter for evaluating disease progression and predicting the outcomes for early-stage patients with non-small cell lung cancer .
25472883 HIV-1 Tat specifically associates with HMGN1 promoter to upregulate HMGN1 expression in T cells
22393258 nucleosome binding protein HMGN1 as a new PCNA-interacting protein that enhances the binding of PCNA to chromatin
22184635 extracellular HMGN1 acts as a novel alarmin critical for LPS-induced development of innate and adaptive immune responses.
22009741 HMGN1 regulates the expression of methyl CpG-binding protein 2 (MECP2) in mouse and human, and affects the behavior of mice
21173166 HMGN1 is not randomly distributed throughout the genome. Instead, the protein preferentially localizes to DNase I hypersensitive (HS) sites, promoters, functional enhancers, and transcription factor binding sites.
19524541 HMGN1 (HMG14) and HMGN2 (HMG17) potently repress ATP-dependent chromatin remodeling by four different molecular motor proteins.
18287527 These studies demonstrate that the mode of binding of HMGNs to chromatin is cell cycle dependent.
17938209 These findings indicate that HMGN1 regulates the expression of particular genes via specific protein-protein interactions with transcription factors at target gene regulatory regions.
More...

AA Sequence

MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET      1 - 70
KEDLPAENGETKTEESPASDEAGEKEAKSD                                             71 - 100
//

Text Mined References (46)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26113410 2015 High-mobility group nucleosome-binding protein 1 is a novel clinical biomarker in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22393258 2012 The nucleosome binding protein HMGN1 interacts with PCNA and facilitates its binding to chromatin.
22184635 2012 High-mobility group nucleosome-binding protein 1 acts as an alarmin and is critical for lipopolysaccharide-induced immune responses.
22009741 2011 The chromatin-binding protein HMGN1 regulates the expression of methyl CpG-binding protein 2 (MECP2) and affects the behavior of mice.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21173166 2011 Genomic profiling of HMGN1 reveals an association with chromatin at regulatory regions.
More...