Property Summary

NCBI Gene PubMed Count 34
PubMed Score 195.21
PubTator Score 109.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Protein-protein Interaction (9)

Gene RIF (15)

AA Sequence

MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET      1 - 70
KEDLPAENGETKTEESPASDEAGEKEAKSD                                             71 - 100
//

Text Mined References (48)

PMID Year Title