Property Summary

NCBI Gene PubMed Count 204
Grant Count 1,024
R01 Count 525
Funding $103,836,435.54
PubMed Score 2595.84
PubTator Score 2265.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P05113 Q13840 IL-5
Symbols EDF
TRF
IL-5

Gene

IL5

PDB

1HUL   3QT2   3VA2  

Gene RIF (174)

PMID Text
26282695 Post-liver transplant patients with food allergy showed a unique cytokine profile in response to various stimuli, with extremely elevated IL-5, low IL-10 secretion.
25937050 It has been shown in this study that the level of IL-5, one of the markers of eosinophilic inflammation, is higher in EBC of children with atopic asthma than in those with nonatopic asthma.
25840634 There was an improvement of the in vitro-cytokine responses in iL-5, IL-10, and interferon-gamma after liver transplantations in end-stage liver disease pediatric patients.
25817862 Production of IL-5 in response to both extract and the Bet v1-derived peptide mix strongly suggested that T cells were a major source of IL-5.
25703059 high levels of IL-33 and a high IL-33/soluble ST2 ratio correlates with elevated levels of IFN-gamma, TNF-alpha and IL-17alpha as well as IL-5, demonstrating that IL-33 has pleiotropic effects.
25613757 Results showed that PAX2 expression is significantly overexpressed in esophageal squamous cell carcinoma tissues and IL-5 is identified as PAX2's effector for metastasis.
25587992 IL-5 may be part of protective mechanisms operating in early atherosclerosis, at least in women
25585038 TRPV1 expression level, IL-4 level, and rs4790522 site mutation are the main risk factors inducing bronchial asthma in children
25121926 Subsequent IL-5-stimulated signaling.
24980230 increased levels in recurrent versus nonrecurrent rhinosinusitis with nasal polyps at the moment of the first surgery
More...

AA Sequence

MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQG      1 - 70
IGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES           71 - 134
//

Text Mined References (204)

PMID Year Title
26282695 2015 Cytokine profile of food-allergic post-liver transplant children is identified by high levels of IL-5 and low IL-10 secretion from patients' peripheral blood mononuclear cells.
25937050 2015 IL-5, IL-8 and MMP -9 levels in exhaled breath condensate of atopic and nonatopic asthmatic children.
25840634 2015 In vitro cytokine changes after pediatric liver transplantation.
25817862 2015 IL-5 production by resident mucosal allergen-specific T cells in an explant model of allergic rhinitis.
25703059 2015 Plasma IL-33 in atopic patients correlates with pro-inflammatory cytokines and changes cholesterol transport protein expression: a surprising neutral overall impact on atherogenicity.
25613757 2015 Upregulation of PAX2 promotes the metastasis of esophageal cancer through interleukin-5.
25587992 2015 Plasma IL-5 concentration and subclinical carotid atherosclerosis.
25585038 2015 Preliminary study on pathogenesis of bronchial asthma in children.
25121926 2014 Cholesterol selectively regulates IL-5 induced mitogen activated protein kinase signaling in human eosinophils.
24980230 Differences in initial immunoprofiles between recurrent and nonrecurrent chronic rhinosinusitis with nasal polyps.
More...