Property Summary

Ligand Count 2
NCBI Gene PubMed Count 210
PubMed Score 2701.91
PubTator Score 2265.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (180)

AA Sequence

MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQG      1 - 70
IGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES           71 - 134
//

Text Mined References (210)

PMID Year Title