Property Summary

NCBI Gene PubMed Count 152
PubMed Score 248.57
PubTator Score 322.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.700 1.4e-05

Protein-protein Interaction (4)

Gene RIF (126)

AA Sequence

MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHR      1 - 70
GSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQ     71 - 140
GTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPE    141 - 210
ATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWI    211 - 280
VYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSF    281 - 350
KYETVPNLLTQHCACI                                                          351 - 366
//

Text Mined References (154)

PMID Year Title