Property Summary

NCBI Gene PubMed Count 144
Grant Count 51
R01 Count 29
Funding $15,855,249.24
PubMed Score 276.39
PubTator Score 322.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.700 0.000

Gene RIF (119)

PMID Text
26654447 the correlation between placental DNAm of INHBA/FN1 and maternal serum INHA/FN1 levels indicate that DNAm may be a useful tool to identify novel biomarkers for adverse pregnancy outcomes in some cases.
26452703 The Sertoli cell hormones inhibin-B and anti Mullerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
25617520 For INHA gene c.-124G>A, males carrying c.-124GG genotype and c.-124GA genotype showed an increased risk of non-normozoospermic syndrome.
25445105 The present study did not find an association between INHA-124A>G and -16C>T and the risk of premature ovarian failure (POF). For the 769G>A mutation, Asian women with the 769A allele were found to be susceptible to POF.
25358080 Inhibin alpha gene expression in human trophoblasts is regulated by interactions between TFAP2 and cAMP signaling pathways.
25329118 Inhibin alpha-subunit, Melan A and MNF116 were not sensitive for pheochromocytomas.
25111790 Aberrant methylation and common genetic variation in the INHA promoter occur in human adrenocortical carcinoma and are associated with decreased INHA expression.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
24269065 When two variant alleles of inhibin alpha gene promoter are combined, the c.-16C>T and c.-124A>G polymorphisms are associated with increased primary ovarian insufficiency risk in Korean women.
24107149 Maternal serum inhibin-A levels were significantly higher in pregnancies with fetal Hb Bart's disease.
More...

AA Sequence

MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHR      1 - 70
GSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQ     71 - 140
GTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPE    141 - 210
ATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWI    211 - 280
VYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSF    281 - 350
KYETVPNLLTQHCACI                                                          351 - 366
//

Text Mined References (146)

PMID Year Title
26654447 2015 Placental DNA methylation at term reflects maternal serum levels of INHA and FN1, but not PAPPA, early in pregnancy.
26452703 2016 The Sertoli cell hormones inhibin-B and anti Müllerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
25617520 2015 Polymorphisms in inhibin ? gene promoter associated with male infertility.
25445105 2014 Gene variation and premature ovarian failure: a meta-analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25358080 2014 Inhibin alpha gene expression in human trophoblasts is regulated by interactions between TFAP2 and cAMP signaling pathways.
25329118 2014 Inhibin alpha-subunit, Melan A and MNF116 in pheochromocytomas.
25111790 2014 Inhibin alpha-subunit (INHA) expression in adrenocortical cancer is linked to genetic and epigenetic INHA promoter variation.
25051334 2014 Inhibin at 90: from discovery to clinical application, a historical review.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
More...