Property Summary

NCBI Gene PubMed Count 235
PubMed Score 2192.82
PubTator Score 1201.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 4.05350678717953E-178
lung carcinoma 2844 3.42702733142768E-24
ulcerative colitis 2087 6.285038243318E-9
chronic lymphosyte leukemia 232 7.0138311133904E-9
tuberculosis 1563 1.79314979603893E-7
non-small cell lung carcinoma 413 1.06484048412093E-6
breast carcinoma 1614 1.59309567744987E-6
lung cancer 4473 2.31784664842046E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.83883804379611E-6
Atopic dermatitis 944 2.06328150434509E-5
ovarian cancer 8492 1.12086989286283E-4
lung adenocarcinoma 2714 1.14266266731713E-4
medulloblastoma, large-cell 6234 1.76833918204853E-4
acute quadriplegic myopathy 1157 2.36561421788345E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.49478830290629E-4
cutaneous lupus erythematosus 1056 7.99058346762216E-4
pituitary cancer 1972 0.00108990729858365
dermatomyositis 967 0.0011331194183617
interstitial cystitis 2299 0.00216715026095756
non diabetic and post-ischemic heart failure 200 0.00301761986591313
medulloblastoma 1524 0.00393806680908422
osteosarcoma 7933 0.00496642667847537
nasopharyngeal carcinoma 1056 0.00533705197712128
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00571614166932459
mucosa-associated lymphoid tissue lymphoma 480 0.0064478865626482
primary Sjogren syndrome 789 0.0102150271657011
atypical teratoid/rhabdoid tumor 1095 0.0182093705891509
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0230122030812117
Waldenstrons macroglobulinemia 765 0.0257611615080749
active Crohn's disease 918 0.031291915761345
type II diabetes mellitus and post-ischemic heart failure 89 0.0319366676378103
glioblastoma 5572 0.0391687308050697
esophageal adenocarcinoma 737 0.0398435703151391
adrenocortical adenoma 134 0.0442459471663643
Breast cancer 3099 0.0469883777432681
invasive ductal carcinoma 2950 0.0495574277780369

Expression

Synonym

Accession P05109 A8K5L3 D3DV37 Q5SY70 Q9UC84 Q9UC92 Q9UCJ0 Q9UCM6
Symbols P8
MIF
NIF
CAGA
CFAG
CGLA
L1Ag
MRP8
CP-10
MA387
60B8AG

Gene

PDB

1MR8   1XK4   4GGF   4XJK   5HLO   5HLV  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

Gene RIF (189)

PMID Text
26878232 The frequency of S100A8+ cells in del(5q) myelodysplastic syndrome human bone marrow positively correlates with disease severity.
26745257 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma
26525587 Data suggest up-regulation of pro-inflammatory molecules TLR9, S100A8, and IL-8 plus lower levels of CD11b+ CD33+ myeloid cells may be involved in impairment of wound healing in type 2 diabetes leading to chronic ulcers, such as diabetic foot ulcers.
26438270 Treg cells suppress the activity of cytotoxic T cells, which kill malaria parasites; therefore, the up-regulation of S100A8 in malaria patients may contribute to pathogen immune escape or tolerance.
26404752 We found that tumor cell proliferation was diminished in the absence of S100A8/A9, leading to significant reduction of tumor size.
26397389 BBP exposure also increased tumor infiltrating myeloid-derived suppressor cell (MDSC) secretion of S100A8/A9, thereby exacerbating the resistance of breast cancer to doxorubicin with cyclophosphamide
26296369 results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation
26266960 Increased soluble gp130 in older patients may inhibit IL-6 trans-signaling, impair barrier function, and decrease S100A8/ S100A9 production in elderly chronic rhinosinusitis patients with asthma and nasal polyps.
26223295 Elevated expression of MRP8/14 are associated with poor prognosis in lupus nephritis.
26110394 High S100A8 expression is associated with Refractory Lupus Nephritis.
More...

AA Sequence

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE      1 - 70
FLILVIKMGVAAHKKSHEESHKE                                                    71 - 93
//

Text Mined References (251)

PMID Year Title
26878232 2016 Rps14 haploinsufficiency causes a block in erythroid differentiation mediated by S100A8 and S100A9.
26745257 2015 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma.
26525587 Increased expression of TLR9 associated with pro-inflammatory S100A8 and IL-8 in diabetic wounds could lead to unresolved inflammation in type 2 diabetes mellitus (T2DM) cases with impaired wound healing.
26438270 2015 Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
26404752 2015 A pro-tumorigenic function of S100A8/A9 in carcinogen-induced hepatocellular carcinoma.
26397389 2015 Benzyl butyl phthalate increases the chemoresistance to doxorubicin/cyclophosphamide by increasing breast cancer-associated dendritic cell-derived CXCL1/GRO? and S100A8/A9.
26296369 2015 Glycosylation-dependent interaction between CD69 and S100A8/S100A9 complex is required for regulatory T-cell differentiation.
26266960 2015 Age-related increased prevalence of asthma and nasal polyps in chronic rhinosinusitis and its association with altered IL-6 trans-signaling.
26223295 2016 Elevated expressions of myeloid-related proteins-8 and -14 are danger biomarkers for lupus nephritis.
26135667 2015 Inflammation-induced S100A8 activates Id3 and promotes colorectal tumorigenesis.
More...