Property Summary

NCBI Gene PubMed Count 278
PubMed Score 631.78
PubTator Score 1201.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (36)

Gene RIF (231)

AA Sequence

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE      1 - 70
FLILVIKMGVAAHKKSHEESHKE                                                    71 - 93
//

Text Mined References (294)

PMID Year Title