Property Summary

NCBI Gene PubMed Count 235
Grant Count 301
R01 Count 181
Funding $42,276,514.38
PubMed Score 2192.82
PubTator Score 1201.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Gastritis 44 7.753 3.9
Duodenal ulcer 20 6.702 3.4
Dyspepsia 34 6.226 3.1
Gastric ulcer 34 6.137 3.1
Cancer 2,346 5.48 2.7
Duodenitis 8 4.721 2.4
Gastroesophageal reflux disease 37 4.103 2.1
Esophagitis 26 3.477 1.7
Barrett's esophagus 183 3.411 1.7
Gastroduodenitis 4 3.369 1.7
Peptic ulcer perforation 3 3.104 1.6
Animal Mammary Neoplasms 136
Atopic dermatitis 944
Breast cancer 3,094
Contact Dermatitis 80
Dermatitis, Atopic 45
Keloid 34
Leukemia, Myelocytic, Acute 113
Waldenstrons macroglobulinemia 765
active Crohn's disease 918
acute quadriplegic myopathy 1,157
adrenocortical adenoma 134
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
chronic lymphosyte leukemia 232
cutaneous lupus erythematosus 1,056
dermatomyositis 933
esophageal adenocarcinoma 737
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
non-small cell lung carcinoma 413
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pituitary cancer 1,972
primary Sjogren syndrome 789
psoriasis 6,685
tuberculosis 1,557
type II diabetes mellitus and post-ische... 89 
ulcerative colitis 2,087

Expression

Synonym

Accession P05109 A8K5L3 D3DV37 Q5SY70 Q9UC84 Q9UC92 Q9UCJ0 Q9UCM6
Symbols P8
MIF
NIF
CAGA
CFAG
CGLA
L1Ag
MRP8
CP-10
MA387
60B8AG

Gene

PDB

1MR8   1XK4   4GGF   4XJK   5HLO   5HLV  

Gene RIF (189)

PMID Text
26878232 The frequency of S100A8+ cells in del(5q) myelodysplastic syndrome human bone marrow positively correlates with disease severity.
26745257 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma
26525587 Data suggest up-regulation of pro-inflammatory molecules TLR9, S100A8, and IL-8 plus lower levels of CD11b+ CD33+ myeloid cells may be involved in impairment of wound healing in type 2 diabetes leading to chronic ulcers, such as diabetic foot ulcers.
26438270 Treg cells suppress the activity of cytotoxic T cells, which kill malaria parasites; therefore, the up-regulation of S100A8 in malaria patients may contribute to pathogen immune escape or tolerance.
26404752 We found that tumor cell proliferation was diminished in the absence of S100A8/A9, leading to significant reduction of tumor size.
26397389 BBP exposure also increased tumor infiltrating myeloid-derived suppressor cell (MDSC) secretion of S100A8/A9, thereby exacerbating the resistance of breast cancer to doxorubicin with cyclophosphamide
26296369 results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation
26266960 Increased soluble gp130 in older patients may inhibit IL-6 trans-signaling, impair barrier function, and decrease S100A8/ S100A9 production in elderly chronic rhinosinusitis patients with asthma and nasal polyps.
26223295 Elevated expression of MRP8/14 are associated with poor prognosis in lupus nephritis.
26110394 High S100A8 expression is associated with Refractory Lupus Nephritis.
More...

AA Sequence

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE      1 - 70
FLILVIKMGVAAHKKSHEESHKE                                                    71 - 93
//

Text Mined References (251)

PMID Year Title
26878232 2016 Rps14 haploinsufficiency causes a block in erythroid differentiation mediated by S100A8 and S100A9.
26745257 2015 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma.
26525587 Increased expression of TLR9 associated with pro-inflammatory S100A8 and IL-8 in diabetic wounds could lead to unresolved inflammation in type 2 diabetes mellitus (T2DM) cases with impaired wound healing.
26438270 2015 Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
26404752 2015 A pro-tumorigenic function of S100A8/A9 in carcinogen-induced hepatocellular carcinoma.
26397389 2015 Benzyl butyl phthalate increases the chemoresistance to doxorubicin/cyclophosphamide by increasing breast cancer-associated dendritic cell-derived CXCL1/GRO? and S100A8/A9.
26296369 2015 Glycosylation-dependent interaction between CD69 and S100A8/S100A9 complex is required for regulatory T-cell differentiation.
26266960 2015 Age-related increased prevalence of asthma and nasal polyps in chronic rhinosinusitis and its association with altered IL-6 trans-signaling.
26223295 2016 Elevated expressions of myeloid-related proteins-8 and -14 are danger biomarkers for lupus nephritis.
26135667 2015 Inflammation-induced S100A8 activates Id3 and promotes colorectal tumorigenesis.
More...