Property Summary

Ligand Count 2
NCBI Gene PubMed Count 137
PubMed Score 785.32
PubTator Score 574.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
posterior fossa group B ependymoma 416 3.4e-07
pituitary cancer 1972 4.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer 2.300 4.4e-05
posterior fossa group B ependymoma 1.800 3.4e-07

Protein-protein Interaction (1)

Gene RIF (118)

AA Sequence

MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWLNLYHFWRETG      1 - 70
THKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVL     71 - 140
LKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESI    141 - 210
TNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY    211 - 280
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD    281 - 350
MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY    351 - 420
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHL    421 - 490
SDVGTTFNLILMPEKPISFTFWPFNQEATQQ                                           491 - 521
//

Text Mined References (139)

PMID Year Title