Property Summary

NCBI Gene PubMed Count 132
PubMed Score 760.07
PubTator Score 574.55

Knowledge Summary


No data available


  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 0.000
pituitary cancer 2.300 0.000


Accession P05108 A8K8D5 B3KPU8 G3XAD7 Q15081 Q16805 Q8N1A7
Symbols CYP11A



3N9Y   3N9Z   3NA0   3NA1  

  Ortholog (8)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624313 screening 0 / 0 / 2 Late stage counterscreen for inhibitors of the orphan nuclear receptor subfamily 0, group B, member 1 (DAX1; NR0B1): absorbance-based cell-based assay to identify inhibitors of the DAX-1 target gene, cytochrome P450, family 11, subfamily A, polypeptide 1 (CYP11A1)

Gene RIF (113)

26750596 An epistatic effect between CYP11A1 and VDR polymorphisms may contribute to the predisposition to childhood asthma.
26631403 These findings contribute in clarifying the relationship between hormones regulating the early phase of steroidogenesis confirming that AMH is playing a suppressive role on CYP19A1 expression stimulated by gonadotropin in hGCs. Furthermore, a similar inhibitory effect for AMH was observed on P450scc gene expression when activated by gonadotropin treatment.
26603348 The study characterizes the intermediates in the second and third steps of the enzymatic process by which P450scc converts cholesterol to pregnenolone.
26332453 In prostate cancer, increased DNA methylation of SRD5A2 and CYP11A1 related to androgen biosynthesis functions may play a role in biochemical recurrence after patients' prostatectomy
25130438 Data indicate a role of cytochrome P450 11A1 (CYP11A1 in sterol metabolism.
24793009 CYP11A1 (tttta)(n) repeat polymorphism appeared to be a potential molecular marker for PCOS risk in our population. Gene-gene and gene-environmental interactions with respect to obesity may play a role in the early onset of this multifactorial condition.
24610422 There may be an association between CYP11A1 promoter pentanucleotide repeat polymorphism and polycystic ovary syndrome. (Meta-analysis)
24244276 the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower.
23852617 This meta-analysis suggests that CYP11A1 microsatellite [TTTA]n repeat polymorphisms may contribute to increasing susceptibility to polycystic ovary syndrome among Caucasian populations.
23756599 The results of this study demonistrated that Cyp11a1 is a target of SF-1 in gonadotroph cells and promotes proliferation/survival of rat pituitary adenoma primary cells and cell lines.

AA Sequence

SDVGTTFNLILMPEKPISFTFWPFNQEATQQ                                           491 - 521

Text Mined References (134)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26750596 2016 1,25D3 prevents CD8(+)Tc2 skewing and asthma development through VDR binding changes to the Cyp11a1 promoter.
26631403 2016 The anti-Müllerian hormone (AMH) acts as a gatekeeper of ovarian steroidogenesis inhibiting the granulosa cell response to both FSH and LH.
26603348 2015 Evidence That Compound I Is the Active Species in Both the Hydroxylase and Lyase Steps by Which P450scc Converts Cholesterol to Pregnenolone: EPR/ENDOR/Cryoreduction/Annealing Studies.
26332453 2015 DNA methylation screening of primary prostate tumors identifies SRD5A2 and CYP11A1 as candidate markers for assessing risk of biochemical recurrence.
25130438 2014 Lumisterol is metabolized by CYP11A1: discovery of a new pathway.
24793009 2014 CYP11A1 microsatellite (tttta)n polymorphism in PCOS women from South India.
24610422 2014 Polymorphisms of pentanucleotide repeats (tttta)n in the promoter of CYP11A1 and their relationships to polycystic ovary syndrome (PCOS) risk: a meta-analysis.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
23852617 2014 Common polymorphisms in the CYP1A1 and CYP11A1 genes and polycystic ovary syndrome risk: a meta-analysis and meta-regression.